Property Summary

NCBI Gene PubMed Count 25
PubMed Score 5.84
PubTator Score 5.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Pancreatic Neoplasm 79
Disease Target Count P-value
psoriasis 6685 9.7e-06
lung cancer 4473 7.3e-04
ependymoma 2514 1.2e-03
oligodendroglioma 2849 2.0e-03
Disease Target Count Z-score Confidence
Alzheimer's disease 644 0.0 2.0
Disease Target Count Z-score Confidence
Cleft Lip 91 4.476 2.2
Cleft palate 125 3.84 1.9

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 1.400 1.2e-03
oligodendroglioma 1.100 2.0e-03
psoriasis -3.000 9.7e-06
lung cancer 1.200 7.3e-04

Gene RIF (12)

PMID Text
25457634 Results suggest that single nucleotide polymorphism in CLPTM1 influences telomere length and so increases risk of melanoma.
20672350 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20572854 Observational study of gene-disease association. (HuGE Navigator)
19937600 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19460752 Knockdown of cleft lip and palate associated transmembrane protein 1 (CLPTM1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
16247549 Observational study of gene-disease association. (HuGE Navigator)
16122939 Observational study of gene-disease association. (HuGE Navigator)
16102578 Identification of inactivating mutations in the JAK1, SYNJ2, and CLPTM1 genes in prostate cancer cells

AA Sequence

MAAAQEADGARSAVVAAGGGSSGQVTSNGSIGRDPPAETQPQNPPAQPAPNAWQVIKGVLFRIFIIWAIS      1 - 70
SWFRRGPAPQDQAGPGGAPRVASRNLFPKDTLMNLHVYISEHEHFTDFNATSALFWEQHDLVYGDWTSGE     71 - 140
NSDGCYEHFAELDIPQSVQQNGSIYIHVYFTKSGFHPDPRQKALYRRLATVHMSRMINKYKRRRFQKTKN    141 - 210
LLTGETEADPEMIKRAEDYGPVEVISHWHPNITINIVDDHTPWVKGSVPPPLDQYVKFDAVSGDYYPIIY    211 - 280
FNDYWNLQKDYYPINESLASLPLRVSFCPLSLWRWQLYAAQSTKSPWNFLGDELYEQSDEEQDSVKVALL    281 - 350
ETNPYLLALTIIVSIVHSVFEFLAFKNDIQFWNSRQSLEGLSVRSVFFGVFQSFVVLLYILDNETNFVVQ    351 - 420
VSVFIGVLIDLWKITKVMDVRLDREHRVAGIFPRLSFKDKSTYIESSTKVYDDMAFRYLSWILFPLLGCY    421 - 490
AVYSLLYLEHKGWYSWVLSMLYGFLLTFGFITMTPQLFINYKLKSVAHLPWRMLTYKALNTFIDDLFAFV    491 - 560
IKMPVMYRIGCLRDDVVFFIYLYQRWIYRVDPTRVNEFGMSGEDPTAAAPVAEVPTAAGALTPTPAPTTT    561 - 630
TATREEASTSLPTKPTQGASSASEPQEAPPKPAEDKKKD                                   631 - 669
//

Text Mined References (30)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25457634 2014 Long telomere length and a TERT-CLPTM1 locus polymorphism association with melanoma risk.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21269460 2011 Initial characterization of the human central proteome.
20672350 2010 Genetic variants in COL2A1, COL11A2, and IRF6 contribute risk to nonsyndromic cleft palate.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20572854 2010 MTHFR and MSX1 contribute to the risk of nonsyndromic cleft lip/palate.
19946888 2010 Defining the membrane proteome of NK cells.
19937600 2010 Testing reported associations of genetic risk factors for oral clefts in a large Irish study population.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16263699 2006 Elucidation of N-glycosylation sites on human platelet proteins: a glycoproteomic approach.
16247549 2006 PAX9 and TGFB3 are linked to susceptibility to nonsyndromic cleft lip with or without cleft palate in the Japanese: population-based and family-based candidate gene analyses.
16122939 2005 Mutation analysis of CLPTM 1 and PVRL 1 genes in patients with non-syndromic clefts of lip, alveolus and palate.
16102578 2005 Identification of inactivating mutations in the JAK1, SYNJ2, and CLPTM1 genes in prostate cancer cells using inhibition of nonsense-mediated decay and microarray analysis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9828125 1998 Characterization of a novel gene disrupted by a balanced chromosomal translocation t(2;19)(q11.2;q13.3) in a family with cleft lip and palate.
9218588 1997 Transgenic expression of a novel thymic epithelial cell antigen stimulates abberant development of thymocytes.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.