Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MMLPQWLLLLFLLFFFLFLLTRGSLSPTKYNLLELKESCIRNQDCETGCCQRAPDNCESHCAEKGSEGSL      1 - 70
CQTQVFFGQYRACPCLRNLTCIYSKNEKWLSIAYGRCQKIGRQKLAKKMFF                        71 - 121
//

Text Mined References (5)

PMID Year Title