Property Summary

NCBI Gene PubMed Count 188
PubMed Score 348.84
PubTator Score 427.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis 1.100 3.7e-02
psoriasis 1.500 1.7e-03
osteosarcoma 4.431 5.4e-14
atypical teratoid / rhabdoid tumor -1.300 1.6e-05
glioblastoma -1.500 9.9e-07
medulloblastoma, large-cell -1.900 5.1e-04
hereditary spastic paraplegia -1.187 2.9e-02
juvenile dermatomyositis 1.264 8.2e-09
Amyotrophic Lateral Sclerosis 1.546 3.2e-06
acute quadriplegic myopathy 1.365 4.4e-05
pancreatic ductal adenocarcinoma liver m... -1.214 4.3e-02
lung cancer -1.200 4.7e-03
diabetes mellitus -1.700 2.7e-03
pediatric high grade glioma -1.100 2.0e-05
ovarian cancer -1.700 3.2e-06

 GWAS Trait (1)

Protein-protein Interaction (11)

Gene RIF (194)

PMID Text
26850841 when overexpressed, c-MYC is able to repress Per1 transactivation by BMAL1/CLOCK via targeting selective E-box sequences. Importantly, upon serum stimulation, MYC was detected in BMAL1 protein complexes
26739996 CLOCK gene variation is associated with incidence of type-2 diabetes and cardiovascular diseases in type-2 diabetic subjects. Suggest diet-gene interaction.
26553137 Clock gene variants associated with obesity and sleep duration. [review]
26453284 The CLOCK 3111T > C polymorphism could be an independent risk factor for irregular menstrual cycles, irrespective of psychological distress and endocrine or metabolic conditions in Korean adolescents.
26390085 Findings indicate that CLOCK protein plays an important role in fertility and its knockdown leads to reduction in reproduction and increased miscarriage risk.
26299356 Upregulation of CLOCK is associated with the expression of HIF-1alpha and VEGF in varicose veins.
26247999 possible circadian rhythm in full-term placental expression
26204460 CLOCK rs1801260 modulated the relationship between early stress, adult history of attempted suicide and current suicide ideation
26181468 Variants of the CLOCK gene are associated with idiopathic male infertility and therefore may be applied as a risk factor of male infertility.
26164627 these findings suggest that sumoylation plays a critical role in the spatiotemporal co-activation of CLOCK-BMAL1 by CBP for immediate-early Per induction and the resetting of the circadian clock.
26134245 CLOCK, ARNTL, and NPAS2 gene polymorphisms may have a role in seasonal variations in mood and behavior
25936801 PASD1 is a circadian bHLH-PAS paralog repressor of CLOCK protein expression.
25775462 minor polymorphisms of CLOCK may be associated with poor morning gastric motility, and may have a combinatorial effect with PER3.
25625359 the circadian gene hClock promoted CRC progression and inhibit tumor cell apoptosis in vitro and in vivo, while silencing hClock was able to reverse this effect.
25527757 Data suggest that influence of obesity-associated CLOCK SNPs (rs12649507, rs6858749) on sleep duration and macronutrient intake can be ameliorated via habitual longer sleep duration and favorable dietary profile (lower protein; higher PUFA).
25309987 The observed interaction effects provide converging evidence that the clock gene and OXT/AVP systems are intertwined and contribute to human prosociality.
25070164 There is not a significant difference in the expression of CLOCK, BMAL1, and PER1 in buccal epithelial cells of patients with essential arterial hypertension regardless of patient genotype.
24919398 Two single nucleotide polymorphisms in RORA were associated with breast cancer in the whole sample and among postmenopausal women, and we also reported an association with CLOCK, RORA, and NPAS2 in the analyses at the gene level
24905098 CLOCK 3111 T/C SNP interacts with emotional eating behavior to modulate total weight loss.
24892753 The results of this study present no evidence for an association of CLOCK polymorphisms with juvenile myoclonic epilepsy.
24824748 CLOCK polymorphisms are associated with increased susceptibility of schizophrenic patients to restless legs syndrome
24821610 SNP (rs6855837) in the CLOCK gene is significant correlation with genotype and allele frequency in lung cancer.
24818524 The CLOCK 3111T/C polymorphism was not significantly associated with overweight or sleep duration.
24789043 E2 promoted the binding of ERalpha to the EREs (estrogen-response elements) of CLOCK promoter, thereby up-regulating the transcription of CLOCK
24636202 No association with SNPs or haplotypes of the CLOCK gene was observed in prophylactic lithium response.
24597447 In an arousal model, prolonged wakefulness has a negative effect on subjective sleepiness and mood in three clock gene PERIOD3 polymorphisms analyzed.
24510388 A population specific variation of MTHFR and hCLOCK genes also highlights ethnicity specific risk management.
24332565 Sleep disruptions may contribute to increases in depressive symptoms via their impact on cognitive control and variation in the CLOCK gene may be associated with sleep quality.
24328727 data support the notion that a chronic consumption of a healthy diet may play a contributing role in triggering glucose metabolism by interacting with the rs1801260 SNP at CLOCK gene locus in metabolic syndrome patients
24235147 The Cdk5-dependent regulation of CLOCK function is mediated by alterations of its stability and subcellular distribution.
24068320 This study failed to show a mediating role of evening preference, ongoing efforts are needed to identify the mechanisms by which the CLOCK gene determines ADHD-related traits.
24037774 The 311T>C polymorphism in the CLOCK1 gene significantly increases the risk for CRC development while it does not affect the outcome of CRC patients.
23970287 CLOCK may interact with HIF-1alpha/ARNT and activate VEGF to stimulate tumor angiogenesis and metastasis.
23912676 Among APOE epsilon4 noncarriers, C carriers in CLOCK gene 3111T/C were associated with a high susceptibility of Alzheimer's disease in a Chinese population.
23871470 Common variants in CLOCK are not associated with measures of sleep duration in people of european ancestry .
23792158 we suggest that as a target of glioma suppressor miR-124, CLOCK positively regulates glioma proliferation and migration by reinforcing NF-kappaB activity
23781009 the CLOCK rs1554483 G allele was associated with increased susceptibility to Alzheimer's disease.
23768840 Selected genetic polymorphisms in the AHR-signaling pathway (i.e., AHRR) and CLOCK may play a role in decreasing the risk for experiencing insomnia during the menopausal transition.
23584858 Data suggest that clock genes Per1, Cry1, Clock, and Bmal1 and their protein products may be directly involved in the daytime-dependent regulation and adaptation of hormone synthesis.
23546644 Studies indicate that in the cytoplasm, PER3 protein heterodimerizes with PER1, PER2, CRY1, and CRY2 proteins and enters into the nucleus, resulting in repression of CLOCK-BMAL1-mediated transcription.
23527142 Genetic variability in the CLOCK gene might be associated with male infertility.
23496259 TNF -alpha modulates expression of the clock gene in rheumatoid arthritis.
23395176 O-GlcNAc transferase (OGT) promotes expression of BMAL1/CLOCK target genes and affects circadian oscillation of clock genes in vitro and in vivo.
23357097 among APOEepsilon4 noncarriers, C carriers in CLOCK gene rs 4580704 were associated with a high susceptibility of Alzheimer's disease
23242607 Loss of Clock expression is associated with skin tumors.
23229515 CLOCK His84 and BMAL1 Leu125 are the key residues for the mutual recognition between CLOCK and BMAL1 bHLH domains.
23221812 findings suggest that the CLOCK C3111T polymorphism may affect personality traits in healthy Japanese subjects.
23183326 C genetic variants in CLOCK 3111T/C display a less robust circadian rhythm than TT and a delayed acrophase that characterizes 'evening-type' subjects.
23160374 enhancement of ERalpha transcriptional activity exerted by wild-type but not mutant (2K/2R) CLOCK in response to estrogen indicated that sumoylation of CLOCK may have an important role in estrogen-dependent signaling
23131019 A significant interaction was observed between the 3111T/C SNP of CLOCK gene and sex for overweight/obesity risk
23129285 Expression of the CLOCK, BMAL1, and PER1 circadian genes in human oral mucosa cells as dependent on CLOCK gene polymorphic variants.
23033538 Data indicate that Clock-Bmal1 regulates the response to glucocorticoids in peripheral tissues through acetylation of the glucocorticoid receptor (GR), possibly antagonizing the biologic actions of diurnally fluctuating circulating cortisol.
23003921 DNA methylation levels at different CpG sites of CLOCK, BMAL1 and PER2 genes were analyzed in sixty normal-weight, overweight and obese women following a 16-week weight reduction program.
22999556 Genetic variation in the CLOCK gene is associated with semen quality in idiopathic male infertility.
22905804 disturbances in clock expression may result in the disruption of the control of normal circadian rhythm, thus benefiting the survival of glioma cells and promoting carcinogenesis.
22823872 The combination of a sensitive genotype (3111C/C) and environmental stress increases vulnerability to circadian rhythm sleep pattern disruption in females.
22806005 Borderline personality disorder may be associated with circadian typology, and perhaps to CLOCK genotypes.
22709985 No significant differences were found in breakfast frequency, energy intake, or HRV between CLOCK 3111T/C minor C allele (T/C or C/C) and T/T subjects.
22578325 RAI1 is a positive transcriptional regulator of CLOCK, pinpointing a novel and important role for this gene in the circadian oscillator
22537959 There is an association between CLOCK gene T3111C polymorphism and both attention deficit hyperactivity disorder and related sleep disturbances in children.
22284746 Findings establish that Clock regulates Thpo and Mpl expression in vivo, and demonstrate an important link between the body's circadian timing mechanisms and megakaryopoiesis.
22232930 The genotype frequency distributions of the polymorphism of the CLOCK gene examined in the EAH and CAD patients were statistically significantly different from that in the individuals without clinical signs of these diseases.
22193177 results suggest that altered promoter methylation may contribute to the abnormal expression of clock genes in Parkinson's disease
22080789 association between the three tagging SNPs (rs3736544, rs1801260, and rs3749474) in CLOCK and risk of bipolar disorder (n=867) and major depressive disorder (n=139) compared to controls (n=889) in the Japanese population
22003994 Our study did not provide evidence for the association between the CLOCK gene 3111C/T polymorphism and personality traits in the Japanese population.
21980503 CLOCK-mediated circadian acetylation of the human GR may function as a target-tissue, gene-specific counter regulatory mechanism to the actions of diurnally fluctuating cortisol
21898035 We conclude that menopause transition induces several changes in the genotype of the adipose tissue chronobiological machinery related to an increased risk of developing MetS.
21773969 CLOCK gene polymorphisms may serve as an independent prognostic marker for colorectal cancer patients.
21734043 The authors report that CLOCK is a component of the transcriptional complex that includes TFIID, ICP4, ICP27, and ICP22.
21714069 Failure to replicate previous research in relation to PERIOD3 and CLOCK concurs with previous research suggesting that the effects of these genes are small and may be related to population composition.
21628555 did not find a significant association between the CLOCK 3111C/T polymorphism and morningness/eveningness or any circadian marker
21479263 REV-ERBalpha plays a dual role in regulation of the activity of the BMAL1/CLOCK heterodimer by regulation of expression of both the BMAL1 and CLOCK genes.
21463335 SiRNA specific inhibition of either Clock or Per2 protein significantly inhibited alcohol-induced monolayer hyperpermeability in intestinal cells.
21386998 Influence of the CLOCK gene may extend to a broad range of variables linked with human behaviors.
21164265 Circadian CLOCK-mediated regulation of target-tissue sensitivity to glucocorticoids: implications for cardiometabolic diseases.
21123577 Disruption of transgenic Clock gene function promotes alterations in nucleus accumbens microcircuits.
21050724 Variations in genes implicated in circadian regulation or its related downstream pathways may be important in the regulation of antropomorphic parameters in patients with schizophrenia during long-term treatment with SGA.
20978934 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20961464 the Clock 3111 T/C SNP might be associated with the existence of sdLDL small dense low-density lipoprotein
20961464 Observational study of gene-disease association. (HuGE Navigator)
20886252 Clock T3111C SNPs do not influence circadian rhythmicity in healthy Italian population.
20886252 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20876123 Circadian CLOCK histone acetyl transferase localizes at ND10 nuclear bodies and enables herpes simplex virus gene expression.
20861012 ID2 can interact with the canonical clock components CLOCK and BMAL1 and mediate inhibitory effects on mPer1 expression
20704703 This study provides evidence for the possible involvement of CLOCK in susceptibility to attention deficit hyperactivity disorder
20704703 Observational study of gene-disease association. (HuGE Navigator)
20653450 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20600471 This study suggested that CLOCK 3111T/C is significant allelic and genotypic associations with bipolar disorder
20600471 Observational study of gene-disease association. (HuGE Navigator)
20560707 meta-analysis shows no association between rs1801260 and mood disorders or depression severity and points out necessity of further research to better understand underlying biological machinery of circadian dysfunction in subjects with mood disorders
20560707 Meta-analysis of gene-disease association. (HuGE Navigator)
20554694 Observational study of gene-disease association. (HuGE Navigator)
20551151 Clock genes have been implicated in cancer-related functions; in this work, we investigated CLOCK as a possible target of somatic mutations in microsatellite unstable colorectal cancers.
20396431 Observational study of gene-disease association. (HuGE Navigator)
20370469 Results do not support the hypothesis of an effect of the T3111C CLOCK variant on sleep disturbances in major depressive disorder.
20370469 Observational study of gene-disease association. (HuGE Navigator)
20368993 Observational study of gene-disease association. (HuGE Navigator)
20364331 The T3111C (RS1801260) polymorphism of hClock gene is associated with schizophrenia, but it seems that the length polymorphism of 18 exon of hPer3 may not be associated with schizophrenia.
20364331 Observational study of gene-disease association. (HuGE Navigator)
20180986 Observational study of gene-disease association. (HuGE Navigator)
20174623 Observational study of gene-disease association. (HuGE Navigator)
20149345 We report an association between variants of the human CLOCK gene and sleep duration in two independent populations. This adds another putative function for CLOCK besides its possible involvement in circadian timing, depression, obesity, and personality.
20149345 Observational study of gene-disease association. (HuGE Navigator)
20124474 Circadian genes influence tumorigenesis, and identify a set of circadian gene variants as candidate breast cancer susceptibility biomarkers.
20081528 We show that endotoxin causes profound suppression of circadian clock gene expression, clearly manifested in human peripheral blood leukocytes, neutrophils, and monocytes.
20072116 Observational study of gene-disease association. (HuGE Navigator)
20065968 The genetic variation in the rs1801260 CLOCK was associated with obesity at baseline and also affected weight loss and patients with the variant allele (G) lost significantly less weight i(P=0.008) compared with wild type.
20065968 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19967263 The frequencies of the shorter allele (4 repeats) in the PER3 gene and the T allele in the CLOCK gene among Asians (0.86 and 0.84, respectively) were significantly higher than among Caucasians (0.69 and 0.71, respectively).
19946213 This investigation begins the characterization of a complex phospho-regulatory site that controls the activity and degradation of CLOCK, a core transcription factor that is essential for circadian behavior.
19934327 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19888304 A novel association of genetic variation at CLOCK with total energy intake, which was particularly relevant for single nucleotide polymorphism rs3749474.
19888304 Observational study of gene-disease association. (HuGE Navigator)
19874574 Observational study of gene-disease association. (HuGE Navigator)
19846548 CLOCK polymorphisms interact with fatty acids to modulate metabolic syndrome X traits.
19846548 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19839995 Observational study of gene-disease association. (HuGE Navigator)
19714310 Evidence suggests metabolic processes feed back into the circadian clock, affecting clock and per2 gene expression and timing of behaviour.
19693801 Observational study of gene-disease association. (HuGE Navigator)
19605937 PER2 is inhibited by BMAL2-CLOCK, which reemphasizes its negative role and a positive role of BMAL2 in circadian transcription
19470168 Observational study of gene-disease association. (HuGE Navigator)
19347611 Results indicate that CLOCK genotype may be a predictor of fluvoxamine treatment response in Japanese major depressive disorder.
19347611 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19328558 Observational study of gene-disease association. (HuGE Navigator)
19296127 expression of CLOCK in breast cancer is associated significantly with 3-year survival
19224106 Data show that there are not significant association between CLOCK gene and pathophysiology of Japanese schizophrenia, bipolar disorder and major depressive disorder.
19224106 Observational study of gene-disease association. (HuGE Navigator)
18974966 Impairment of the circadian clock protein appears to be closely associated with the pathophysiology of type 2 diabetes in humans.
18957941 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18854154 Knockdown of clock homolog (mouse, CLOCK) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18587630 The transcription of human nocturnin gene displayed circadian oscillations in Huh7 cells (a human hepatoma cell line) and was regulated by CLOCK/BMAL1 heterodimer via the E-box of nocturnin promoter.
18541547 Putative role of the CLOCK polymorphism and related haplotypes in susceptibility to obesity.
18541547 Observational study of gene-disease association. (HuGE Navigator)
18458078 HAT gene expression is required for cisplatin resistance and Clock and Tip60 regulate not only transcription, but also DNA repair, through periodic histone acetylation
18430226 The regulators of clock-controlled transcription PER2, CRY1 and CRY2 differ in their capacity to interact with each single component of the BMAL1-CLOCK heterodimer and, in the case of BMAL1, also in their interaction sites.
18419323 Evidence linking circadian rhythms, the Clock gene, and bipolar disorder is discussed, along with the possible biology that underlies this connection. Review.
18411297 DEC1, along with DEC2, plays a role in the finer regulation and robustness of the molecular clock CLOCK/BMAL1
18379422 No relationship between hCLOCK T3111C polymorphism and endometriosis, nor any effect of the polymorphism on the relationship of shift work to endometriosis.
18379422 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18314271 Present findings show for the first time that the 3111T/C SNP of the CLOCK gene is not associated to human obesity and/or BED, but it seems to predispose obese individuals to a higher BMI.
18314271 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18283403 study does not support the hypothesis that the T3111C CLOCK polymorphism is associated with cluster headache
18228528 A multi-locus interaction between rs6442925 in the 5' upstream of BHLHB2, rs1534891 in CSNK1E, and rs534654 near the 3' end of the CLOCK gene, however, is significantly associated with bipolar disorder
18228528 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18071340 the Clock gene CGC haplotype may be protective for the development of obesity and support the hypothesis that genetic variation in the Clock gene may play a role in the development of the metabolic syndrome, type 2 diabetes and cardiovascular disease.
18071340 Observational study of gene-disease association. (HuGE Navigator)
17994337 CLOCK/BMAL1-mediated activation of PER1 by AP1 and E-Box elements is distinct from peripheral transcriptional modulation via cAMP-induced CREB and C/EBP.
17948273 This is the first study suggesting that a polymorphism of a gene within the circadian "clock" mechanism is a direct or linked contributing factor in adult ADHD
17948273 Observational study of gene-disease association. (HuGE Navigator)
17848551 peripheral clock in vascular endothelial cells regulates TM gene expression and that the oscillation of TM expression may contribute to the circadian variation of cardiovascular events
17701674 Observational study of gene-disease association. (HuGE Navigator)
17701674 Allelic variants interaction of CLOCK gene and GNB3 subunit gene with diurnal preference.
17696255 Observational study of gene-disease association. (HuGE Navigator)
17696255 Our study suggests a potential role of the CLOCK polymorphisms and their haplotypes in susceptibility to nonalcoholic fatty liver disease and disease severity.
17551301 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17516548 Observational study of gene-disease association. (HuGE Navigator)
17516548 polymorphism of the CLOCK gene confers a predisposition to a lifetime lower body weight in patients with anorexia nervosa and bulimia nervosa
17469042 The difference between the mean value for the lowest expression individual (DeltaCT 8.8) and the highest expression individual (DeltaCT 3.7) revealed an approximately 34-fold difference in relative clock gene expression levels.
17428266 CLOCK 3111 T/C SNP was associated with activity levels in the second part of the day, neuropsychological performance and BOLD fMRI correlates (interaction of genotype and moral valence of the stimuli).
17428266 Observational study of gene-disease association. (HuGE Navigator)
17364575 Observational study of gene-disease association. (HuGE Navigator)
17364575 These results show that there is no association between either polymorphism T3111C or T257G in the Clock gene with diurnal preference or delayed sleep phase syndrome (DSPS).
17264841 Observational study of gene-disease association. (HuGE Navigator)
17239050 Observational study of gene-disease association. (HuGE Navigator)
17221848 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17221848 compared to T/T homozygotes, bipolar depressed carriers of the C allele had a similar degree of severity of depression, but showed higher activity levels in the evening, a delayed sleep onset and a reduced amount of sleep during the night
17116390 Observational study of gene-disease association. (HuGE Navigator)
17116390 The results of this study suggests that the T3111C polymorphism of the CLOCK gene is associated with schizophrenia.
17106427 Observational study of gene-disease association. (HuGE Navigator)
16528748 Observational study of gene-disease association. (HuGE Navigator)
16474406 a molecular genetic screen in mammalian cells to identify mutants of the circadian transcriptional activators CLOCK and BMAL1.
16232160 Observational study of gene-disease association. (HuGE Navigator)
16125818 Single nucleotide polymorphism is not associated with narcolepsy.
16024980 Single Nucleotide Polymorphism in the 3'-untranslated region of clock gene is associated with Sleep Disorders
15952199 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15952199 Findings may suggest that CLOCK genotype influences the time course of insomnia during antidepressant treatment.
15917222 RNA interference against beta-TRCP greatly decreases Clock-dependent gene expression in tissue culture cells, indicating that beta-TRCP controls endogenous Per1 activity and the circadian clock by directly targeting Per1 for degradation
15905809 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15578592 Observational study of gene-disease association. (HuGE Navigator)
15578592 Findings suggest the significance of the association of the 3111C/C allele of hClock with evening preference in a Japanese population sample.
15572273 Observational study of gene-disease association. (HuGE Navigator)
15475734 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15331141 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14750904 CLOCK was cloned & sequenced and its circadian expression studied.
14582141 Observational study of gene-disease association. (HuGE Navigator)
14582141 a role for the CLOCK gene polymorphism in the regulation of long-term illness recurrence in bipolar disorder
12898572 Observational study of gene-disease association. (HuGE Navigator)
12897057 BMAL1 and CLOCK have roles in circadian system control
12841365 Observational study of gene-disease association. (HuGE Navigator)
12464098 Observational study of gene-disease association. (HuGE Navigator)
11927173 Observational study of gene-disease association. (HuGE Navigator)
10198158 essential regulator of circadian rhythms

AA Sequence

MLFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDK      1 - 70
STVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDGFFLAIMTDGSIIYVSESVTS     71 - 140
LLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSLTPEYLKSKNQLEFCCHMLRGTIDPKEPSTY    141 - 210
EYVKFIGNFKSLNSVSSSAHNGFEGTIQRTHRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRH    211 - 280
SLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIW    281 - 350
LQTHYYITYHQWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAADKSQDSGSDNRINTVSLKEA    351 - 420
LERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRQHLPAHEKMVQRRSSFSSQSINSQSV    421 - 490
GSSLTQPVMSQATNLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEANIHRQQEELRKIQEQLQMVHG    491 - 560
QGLQMFLQQSNPGLNFGSVQLSSGNSSNIQQLAPINMQGQVVPTNQIQSGMNTGHIGTTQHMIQQQTLQS    561 - 630
TSTQSQQNVLSGHSQQTSLPSQTQSTLTAPLYNTMVISQPAAGSMVQIPSSMPQNSTQSAAVTTFTQDRQ    631 - 700
IRFSQGQQLVTKLVTAPVACGAVMVPSTMLMGQVVTAYPTFATQQQQSQTLSVTQQQQQQSSQEQQLTSV    701 - 770
QQPSQAQLTQPPQQFLQTSRLLHGNPSTQLILSAAFPLQQSTFPQSHHQQHQSQQQQQLSRHRTDSLPDP    771 - 840
SKVQPQ                                                                    841 - 846
//

Text Mined References (193)

PMID Year Title
26850841 2016 c-MYC targets the central oscillator gene Per1 and is regulated by the circadian clock at the post-transcriptional level.
26739996 2016 CLOCK gene variation is associated with incidence of type-2 diabetes and cardiovascular diseases in type-2 diabetic subjects: dietary modulation in the PREDIMED randomized trial.
26553137 2015 Association between genetic variants of the clock gene and obesity and sleep duration.
26453284 2015 Association between the CLOCK gene 3111 T?>?C polymorphism and an irregular menstrual cycle in Korean adolescents.
26390085 2015 Circadian clock gene plays a key role on ovarian cycle and spontaneous abortion.
26299356 2015 Upregulation of the gene expression of CLOCK is correlated with hypoxia-inducible factor 1? in advanced varicose lesions.
26247999 2015 Evidence for clock genes circadian rhythms in human full-term placenta.
26204460 2015 Effects of CLOCK gene variants and early stress on hopelessness and suicide in bipolar depression.
26181468 2015 Variants of the CLOCK gene affect the risk of idiopathic male infertility in the Han-Chinese population.
26164627 2015 Sumoylation controls CLOCK-BMAL1-mediated clock resetting via CBP recruitment in nuclear transcriptional foci.
26134245 2015 Association of CLOCK, ARNTL, and NPAS2 gene polymorphisms and seasonal variations in mood and behavior.
25936801 2015 Cancer/Testis Antigen PASD1 Silences the Circadian Clock.
25775462 2015 Circadian rhythm genes CLOCK and PER3 polymorphisms and morning gastric motility in humans.
25625359 2015 Circadian gene hClock enhances proliferation and inhibits apoptosis of human colorectal carcinoma cells in vitro and in vivo.
25527757 2015 Habitual sleep duration is associated with BMI and macronutrient intake and may be modified by CLOCK genetic variants.
25309987 2014 Clock gene modulates roles of OXTR and AVPR1b genes in prosociality.
25070164 2014 Expression of circadian rhythm genes CLOCK, BMAL1, and PER1 in buccal epithelial cells of patients with essential arterial hypertension in dependence on polymorphic variants of CLOCK and BMAL1 genes.
24919398 2014 Breast cancer risk, nightwork, and circadian clock gene polymorphisms.
24905098 2014 CLOCK 3111 T/C SNP interacts with emotional eating behavior for weight-loss in a Mediterranean population.
24892753 2014 PER2 rs2304672, CLOCK rs1801260, and PER3 rs57875989 polymorphisms are not associated with juvenile myoclonic epilepsy.
24824748 2014 Association between restless legs syndrome and CLOCK and NPAS2 gene polymorphisms in schizophrenia.
24821610 2014 Association between CLOCK, PER3 and CCRN4L with non?small cell lung cancer in Brazilian patients.
24818524 Study of the association between 3111T/C polymorphism of the CLOCK gene and the presence of overweight in schoolchildren.
24789043 2014 Induction of the CLOCK gene by E2-ER? signaling promotes the proliferation of breast cancer cells.
24636202 2014 Polymorphism of circadian clock genes and prophylactic lithium response.
24597447 2013 Effects of prolonged wakefulness: the role of PERIOD3 genotypes and personality traits.
24510388 2014 Circadian rhythm of homocysteine is hCLOCK genotype dependent.
24332565 2014 Sleep and sadness: exploring the relation among sleep, cognitive control, and depressive symptoms in young adults.
24328727 2014 Beneficial effect of CLOCK gene polymorphism rs1801260 in combination with low-fat diet on insulin metabolism in the patients with metabolic syndrome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24235147 2013 Cyclin-dependent kinase 5 (Cdk5) regulates the function of CLOCK protein by direct phosphorylation.
24068320 2014 Human CLOCK gene-associated attention deficit hyperactivity disorder-related features in healthy adults: quantitative association study using Wender Utah Rating Scale.
24037774 2013 Association of the clock genes polymorphisms with colorectal cancer susceptibility.
24005054 2014 A meeting of two chronobiological systems: circadian proteins Period1 and BMAL1 modulate the human hair cycle clock.
23970287 2013 hClock gene expression in human colorectal carcinoma.
23916625 2014 Molecular architecture of the mammalian circadian clock.
23912676 2013 The polymorphism of CLOCK gene 3111T/C C>T is associated with susceptibility of Alzheimer disease in Chinese population.
23871470 2013 Common variants in CLOCK are not associated with measures of sleep duration in people of european ancestry from the sleep heart health study.
23792158 2013 Circadian gene Clock contributes to cell proliferation and migration of glioma and is directly regulated by tumor-suppressive miR-124.
23785138 2013 p75 neurotrophin receptor is a clock gene that regulates oscillatory components of circadian and metabolic networks.
23781009 2013 Functional CLOCK gene rs1554483 G/C polymorphism is associated with susceptibility to Alzheimer's disease in the Chinese population.
23768840 2013 Genetic polymorphisms in the aryl hydrocarbon receptor-signaling pathway and sleep disturbances in middle-aged women.
23584858 2013 Clock gene expression in the human pituitary gland.
23576606 2013 Mechanism of the circadian clock in physiology.
23546644 2013 Analysis of the molecular pathophysiology of sleep disorders relevant to a disturbed biological clock.
23527142 2013 Genetic variation in circadian rhythm genes CLOCK and ARNTL as risk factor for male infertility.
23496259 2013 TNF-? modulates expression of the circadian clock gene Per2 in rheumatoid synovial cells.
23395176 2013 O-GlcNAc signaling entrains the circadian clock by inhibiting BMAL1/CLOCK ubiquitination.
23357097 2013 Polymorphism of CLOCK gene rs 4580704 C > G is associated with susceptibility of Alzheimer's disease in a Chinese population.
23303907 2013 Metabolism and the circadian clock converge.
23242607 2013 Altered expression patterns of clock gene mRNAs and clock proteins in human skin tumors.
23229515 2013 Intermolecular recognition revealed by the complex structure of human CLOCK-BMAL1 basic helix-loop-helix domains with E-box DNA.
23221812 2013 The CLOCK C3111T polymorphism is associated with reward dependence in healthy Japanese subjects.
23183326 2013 Differences in circadian rhythmicity in CLOCK 3111T/C genetic variants in moderate obese women as assessed by thermometry, actimetry and body position.
23160374 2013 CLOCK is a substrate of SUMO and sumoylation of CLOCK upregulates the transcriptional activity of estrogen receptor-?.
23131019 2012 Physical activity and sex modulate obesity risk linked to 3111T/C gene variant of the CLOCK gene in an elderly population: the SUN Project.
23129285 Expression of the CLOCK, BMAL1, and PER1 circadian genes in human oral mucosa cells as dependent on CLOCK gene polymorphic variants.
23033538 2012 Circadian rhythms of glucocorticoid hormone actions in target tissues: potential clinical implications.
23003921 2012 CLOCK, PER2 and BMAL1 DNA methylation: association with obesity and metabolic syndrome characteristics and monounsaturated fat intake.
22999556 2012 Association of CLOCK gene variants with semen quality in idiopathic infertile Han-Chinese males.
22905804 2013 Deregulated expression of the clock genes in gliomas.
22823872 2012 The 3111T/C polymorphism interacts with stressful life events to influence patterns of sleep in females.
22806005 2012 Sleep disturbances and circadian CLOCK genes in borderline personality disorder.
22709985 2012 The CLOCK 3111T/C SNP is associated with morning gastric motility in healthy young women.
22578325 2012 Smith-Magenis syndrome results in disruption of CLOCK gene transcription and reveals an integral role for RAI1 in the maintenance of circadian rhythmicity.
22537959 2012 [Association of CLOCK gene T3111C polymorphism with attention deficit hyperactivity disorder and related sleep disturbances in children].
22284746 2012 Diurnal expression of the thrombopoietin gene is regulated by CLOCK.
22232930 2011 [Association of T3111C polymorphism in 3'-untranslated region of the CLOCK gene with the risk of essential arterial hypertension and coronary artery disease in the Russian population Karelia].
22193177 2012 Promoter methylation analysis of seven clock genes in Parkinson's disease.
22080789 2011 The CLOCK gene and mood disorders: a case-control study and meta-analysis.
22003994 2011 No association between CLOCK gene 3111C/T polymorphism and personality traits in healthy Japanese subjects.
21980503 2011 Peripheral CLOCK regulates target-tissue glucocorticoid receptor transcriptional activity in a circadian fashion in man.
21960634 2011 Histone lysine demethylase JARID1a activates CLOCK-BMAL1 and influences the circadian clock.
21898035 2012 Influence of menopause on adipose tissue clock gene genotype and its relationship with metabolic syndrome in morbidly obese women.
21773969 2012 Functional polymorphisms of circadian positive feedback regulation genes and clinical outcome of Chinese patients with resected colorectal cancer.
21734043 2011 The histone acetyltransferase CLOCK is an essential component of the herpes simplex virus 1 transcriptome that includes TFIID, ICP4, ICP27, and ICP22.
21714069 2011 Sleep quality and diurnal preference in a sample of young adults: associations with 5HTTLPR, PER3, and CLOCK 3111.
21659603 2011 A DNA damage response screen identifies RHINO, a 9-1-1 and TopBP1 interacting protein required for ATR signaling.
21628555 2011 Human diurnal preference and circadian rhythmicity are not associated with the CLOCK 3111C/T gene polymorphism.
21613214 2011 Biochemical analysis of the canonical model for the mammalian circadian clock.
21479263 2011 Direct regulation of CLOCK expression by REV-ERB.
21463335 2011 Role of intestinal circadian genes in alcohol-induced gut leakiness.
21386998 2011 Ghrelin, sleep reduction and evening preference: relationships to CLOCK 3111 T/C SNP and weight loss.
21164265 2011 Circadian CLOCK-mediated regulation of target-tissue sensitivity to glucocorticoids: implications for cardiometabolic diseases.
21123577 2010 Lithium ameliorates nucleus accumbens phase-signaling dysfunction in a genetic mouse model of mania.
21050724 2011 Clock genes and body composition in patients with schizophrenia under treatment with antipsychotic drugs.
20978934 2011 The role of polymorphisms in circadian pathway genes in breast tumorigenesis.
20961464 2010 The association of the Clock 3111 T/C SNP with lipids and lipoproteins including small dense low-density lipoprotein: results from the Mima study.
20886252 2011 Clock T3111C and Per2 C111G SNPs do not influence circadian rhythmicity in healthy Italian population.
20876123 2010 Circadian CLOCK histone acetyl transferase localizes at ND10 nuclear bodies and enables herpes simplex virus gene expression.
20861012 2010 The transcriptional repressor ID2 can interact with the canonical clock components CLOCK and BMAL1 and mediate inhibitory effects on mPer1 expression.
20704703 2010 Association study between a polymorphism at the 3'-untranslated region of CLOCK gene and attention deficit hyperactivity disorder.
20653450 2010 Gene-gene interaction between serotonin transporter (SLC6A4) and CLOCK modulates the risk of metabolic syndrome in rotating shiftworkers.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20600471 2010 Association between CLOCK 3111T/C and preferred circadian phase in Korean patients with bipolar disorder.
20560707 2010 T3111C clock single nucleotide polymorphism and mood disorders: a meta-analysis.
20554694 Circadian clock gene polymorphisms in alcohol use disorders and alcohol consumption.
20551151 2010 Mutations in the circadian gene CLOCK in colorectal cancer.
20396431 2010 Genotyping sleep disorders patients.
20370469 2010 3111T/C clock gene polymorphism is not associated with sleep disturbances in untreated depressed patients.
20368993 2010 ARNTL (BMAL1) and NPAS2 gene variants contribute to fertility and seasonality.
20364331 2011 The association of CLOCK gene T3111C polymorphism and hPER3 gene 54-nucleotide repeat polymorphism with Chinese Han people schizophrenics.
20180986 2010 CLOCK is suggested to associate with comorbid alcohol use and depressive disorders.
20174623 2010 Systematic analysis of circadian genes in a population-based sample reveals association of TIMELESS with depression and sleep disturbance.
20149345 2010 CLOCK gene variants associate with sleep duration in two independent populations.
20124474 2010 CLOCK in breast tumorigenesis: genetic, epigenetic, and transcriptional profiling analyses.
20081528 2010 In vivo endotoxin synchronizes and suppresses clock gene expression in human peripheral blood leukocytes.
20072116 2010 Differential association of circadian genes with mood disorders: CRY1 and NPAS2 are associated with unipolar major depression and CLOCK and VIP with bipolar disorder.
20065968 2010 CLOCK gene is implicated in weight reduction in obese patients participating in a dietary programme based on the Mediterranean diet.
19967263 2010 Do Caucasian and Asian clocks tick differently?
19946213 2009 A serine cluster mediates BMAL1-dependent CLOCK phosphorylation and degradation.
19934327 2009 Testing the circadian gene hypothesis in prostate cancer: a population-based case-control study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19888304 2010 Genetic variants in human CLOCK associate with total energy intake and cytokine sleep factors in overweight subjects (GOLDN population).
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19846548 2009 CLOCK genetic variation and metabolic syndrome risk: modulation by monounsaturated fatty acids.
19839995 2009 Association study of 21 circadian genes with bipolar I disorder, schizoaffective disorder, and schizophrenia.
19714310 2009 A time to fast, a time to feast: the crosstalk between metabolism and the circadian clock.
19693801 2010 PER2 variantion is associated with depression vulnerability.
19605937 2009 Preferential inhibition of BMAL2-CLOCK activity by PER2 reemphasizes its negative role and a positive role of BMAL2 in the circadian transcription.
19470168 2009 NPAS2 and PER2 are linked to risk factors of the metabolic syndrome.
19347611 2009 CLOCK may predict the response to fluvoxamine treatment in Japanese major depressive disorder patients.
19328558 2009 Case-control association study of 65 candidate genes revealed a possible association of a SNP of HTR5A to be a factor susceptible to bipolar disease in Bulgarian population.
19296127 2009 Disturbance of circadian gene expression in breast cancer.
19224106 2009 Association study of clock gene (CLOCK) and schizophrenia and mood disorders in the Japanese population.
18974966 2009 Clock gene expression in peripheral leucocytes of patients with type 2 diabetes.
18957941 2010 Genome-wide association scan for five major dimensions of personality.
18587630 2008 CLOCK/BMAL1 regulates human nocturnin transcription through binding to the E-box of nocturnin promoter.
18541547 2008 Genetic variants of Clock transcription factor are associated with individual susceptibility to obesity.
18458078 2008 Tip60 is regulated by circadian transcription factor clock and is involved in cisplatin resistance.
18430226 2008 Interaction of circadian clock proteins PER2 and CRY with BMAL1 and CLOCK.
18419323 2007 Role for the Clock gene in bipolar disorder.
18411297 2008 DEC1 modulates the circadian phase of clock gene expression.
18379422 2008 Shift work, hCLOCK T3111C polymorphism, and endometriosis risk.
18314271 2008 Investigation of 3111T/C polymorphism of the CLOCK gene in obese individuals with or without binge eating disorder: association with higher body mass index.
18283403 2008 Investigation of the T3111C CLOCK gene polymorphism in cluster headache.
18228528 2008 Clock genes may influence bipolar disorder susceptibility and dysfunctional circadian rhythm.
18071340 2008 Association between polymorphisms in the Clock gene, obesity and the metabolic syndrome in man.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17994337 2007 Activation of human period-1 by PKA or CLOCK/BMAL1 is conferred by separate signal transduction pathways.
17948273 2008 A polymorphism at the 3'-untranslated region of the CLOCK gene is associated with adult attention-deficit hyperactivity disorder.
17848551 2007 Thrombomodulin is a clock-controlled gene in vascular endothelial cells.
17701674 2007 Allelic variants interaction of CLOCK gene and G-protein beta3 subunit gene with diurnal preference.
17696255 2007 Common genetic variations in CLOCK transcription factor are associated with nonalcoholic fatty liver disease.
17551301 2007 Favorable genetic polymorphisms predictive of clinical outcome of chemoradiotherapy for stage II/III esophageal squamous cell carcinoma in Japanese.
17516548 2007 The 3111T/C polymorphism of the CLOCK gene confers a predisposition to a lifetime lower body weight in patients with anorexia nervosa and bulimia nervosa: a preliminary study.
17469042 2007 Inter-subject differences in constitutive expression levels of the clock gene in man.
17428266 2008 Clock genes beyond the clock: CLOCK genotype biases neural correlates of moral valence decision in depressed patients.
17364575 2007 Clock polymorphisms and circadian rhythms phenotypes in a sample of the Brazilian population.
17264841 2007 Association of Per1 and Npas2 with autistic disorder: support for the clock genes/social timing hypothesis.
17239050 2007 CLOCK gene 3111C/T polymorphism is not associated with seasonal variations in mood and behavior in Korean college students.
17221848 2007 Actimetric evidence that CLOCK 3111 T/C SNP influences sleep and activity patterns in patients affected by bipolar depression.
17116390 2007 CLOCK gene T3111C polymorphism is associated with Japanese schizophrenics: a preliminary study.
17106427 2006 Human clock, PER1 and PER2 polymorphisms: lack of association with cocaine dependence susceptibility and cocaine-induced paranoia.
16678094 2006 Circadian regulator CLOCK is a histone acetyltransferase.
16528748 2006 Suggestive evidence for association of the circadian genes PERIOD3 and ARNTL with bipolar disorder.
16474406 2006 Feedback repression is required for mammalian circadian clock function.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16232160 2005 Lack of association between the 3092 T-->C Clock gene polymorphism and cluster headache.
16125818 2005 Clock gene polymorphisms and narcolepsy in positive and negative HLA-DQB1*0602 patients.
16024980 Two new rare variants in the circadian "clock" gene may influence sleep pattern.
15952199 2005 Insomnia improvement during antidepressant treatment and CLOCK gene polymorphism.
15917222 2005 SCFbeta-TRCP controls clock-dependent transcription via casein kinase 1-dependent degradation of the mammalian period-1 (Per1) protein.
15905809 2005 Circadian variability of pharmacokinetics of 5-fluorouracil and CLOCK T3111C genetic polymorphism in patients with esophageal carcinoma.
15578592 2005 The 3111T/C polymorphism of hClock is associated with evening preference and delayed sleep timing in a Japanese population sample.
15572273 2005 No association of clock gene T3111C polymorphism and affective disorders.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15475734 2004 Pharmacogenetics of selective serotonin reuptake inhibitor response: a 6-month follow-up.
15331141 2004 Genetic dissection of drug effects in clinical practice: CLOCK gene and clozapine-induced diurnal sleepiness.
14750904 2004 Phosphorylation of clock protein PER1 regulates its circadian degradation in normal human fibroblasts.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14701732 2004 Direct association between mouse PERIOD and CKIepsilon is critical for a functioning circadian clock.
14645221 2004 Histone acetyltransferase-dependent chromatin remodeling and the vascular clock.
14582141 2003 Influence of CLOCK gene polymorphism on circadian mood fluctuation and illness recurrence in bipolar depression.
12898572 2003 Genetic dissection of psychopathological symptoms: insomnia in mood disorders and CLOCK gene polymorphism.
12897057 2003 BMAL1-dependent circadian oscillation of nuclear CLOCK: posttranslational events induced by dimerization of transcriptional activators of the mammalian clock system.
12841365 2003 A length polymorphism in the circadian clock gene Per3 is linked to delayed sleep phase syndrome and extreme diurnal preference.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12464098 2002 The 3111 Clock gene polymorphism is not associated with sleep and circadian rhythmicity in phenotypically characterized human subjects.
11927173 2002 Identification of a naturally occurring polymorphism in the promoter region of the norepinephrine transporter and analysis in major depression.
11927136 2002 Mutation screening of the human Clock gene in circadian rhythm sleep disorders.
11511917 2001 The polyglutamine motif is highly conserved at the Clock locus in various organisms and is not polymorphic in humans.
11441146 2001 Regulation of clock and NPAS2 DNA binding by the redox state of NAD cofactors.
11337377 2001 Circadian expression of clock genes in human oral mucosa and skin: association with specific cell-cycle phases.
11018023 2000 CLIF, a novel cycle-like factor, regulates the circadian oscillation of plasminogen activator inhibitor-1 gene expression.
10973243 2000 Circadian rhythm genetics: from flies to mice to humans.
10864977 2000 The basic helix-loop-helix-PAS protein MOP9 is a brain-specific heterodimeric partner of circadian and hypoxia factors.
10198158 1999 Molecular cloning and characterization of the human CLOCK gene: expression in the suprachiasmatic nuclei.
9989497 1999 A molecular mechanism regulating rhythmic output from the suprachiasmatic circadian clock.
9779516 1998 A CLOCK polymorphism associated with human diurnal preference.
9576906 1998 The basic-helix-loop-helix-PAS orphan MOP3 forms transcriptionally active complexes with circadian and hypoxia factors.
9205841 1997 Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.