Property Summary

NCBI Gene PubMed Count 34
PubMed Score 51.60
PubTator Score 40.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.474 4.2e-03
Multiple myeloma 2.004 7.8e-05
osteosarcoma 1.022 1.4e-02
intraductal papillary-mucinous adenoma (... 1.700 6.7e-04
intraductal papillary-mucinous carcinoma... 1.400 5.5e-03
lung cancer 1.600 7.0e-05
ovarian cancer -1.100 6.3e-04
dermatomyositis 1.100 4.8e-03

Gene RIF (9)

PMID Text
24298023 the S. pombe ICln protein is required for optimal production of the spliceosomal snRNPs and for efficient splicing in vivo
21917931 functional interaction between ICln and HSPC038
21081503 RioK1, a new interactor of protein arginine methyltransferase 5 (PRMT5), competes with pICln for binding and modulates PRMT5 complex composition and substrate specificity.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18187620 Knockdown of chloride channel, nucleotide-sensitive, 1A (CLNS1A) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
16087681 Lsm10 and Lsm11, which replace the Sm proteins D1 and D2 in the histone RNA processing U7 snRNPs, associate with pICln in vitro and in vivo without receiving sDMA modifications and with PRMT5 and SMN complexes
15905169 Data show that ICln159, a truncated ICln mutant, belongs to the pleckstrin homology (PH) domain family of proteins and interacts with LSm4, a protein involved in splicing and mRNA degradation.
15075326 ICln interacts with integrin alphaIIbbeta3 and regulates platelet activation.
14960305 revealed an increase of ICln in the mesothelioma cell membrane under hypotonic conditions, an event possibly related to the activation of Cl(-) channels

AA Sequence

MSFLKSFPPPGPAEGLLRQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHALSRDR      1 - 70
SDCLGEHLYVMVNAKFEEESKEPVADEEEEDSDDDVEPITEFRFVPSDKSALEAMFTAMCECQALHPDPE     71 - 140
DEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQATLERLEGMLSQSVSSQYNMAGVRTEDS    141 - 210
IRDYEDGMEVDTTPTVAGQFEDADVDH                                               211 - 237
//

Text Mined References (49)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24298023 2014 Characterization and in vivo functional analysis of the Schizosaccharomyces pombe ICLN gene.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21917931 2011 The molecular and functional interaction between ICln and HSPC038 proteins modulates the regulation of cell volume.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21081503 2011 RioK1, a new interactor of protein arginine methyltransferase 5 (PRMT5), competes with pICln for binding and modulates PRMT5 complex composition and substrate specificity.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18984161 2008 An assembly chaperone collaborates with the SMN complex to generate spliceosomal SnRNPs.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18495660 2008 Promiscuous modification of the nuclear poly(A)-binding protein by multiple protein-arginine methyltransferases does not affect the aggregation behavior.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17487921 2007 Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16734741 The ICln interactome.
16368544 2006 New insights into potential functions for the protein 4.1 superfamily of proteins in kidney epithelium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16087681 2005 Toward an assembly line for U7 snRNPs: interactions of U7-specific Lsm proteins with PRMT5 and SMN complexes.
16033995 2005 Chloride channels in physiological volume regulation of human spermatozoa.
15905169 2005 ICln159 folds into a pleckstrin homology domain-like structure. Interaction with kinases and the splicing factor LSm4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15130578 2004 Why do cells need an assembly machine for RNA-protein complexes?
15075326 2004 ICln, a novel integrin alphaIIbbeta3-associated protein, functionally regulates platelet activation.
14960305 2004 Volume-regulated Cl- channels in human pleural mesothelioma cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11756452 2002 A novel WD repeat protein component of the methylosome binds Sm proteins.
11747828 2001 Methylation of Sm proteins by a complex containing PRMT5 and the putative U snRNP assembly factor pICln.
11713266 2001 The methylosome, a 20S complex containing JBP1 and pICln, produces dimethylarginine-modified Sm proteins.
10825435 2000 Modulation of volume regulated anion current by I(Cln).
10330151 1999 pICln inhibits snRNP biogenesis by binding core spliceosomal proteins.
9694734 1998 The 30-kD domain of protein 4.1 mediates its binding to the carboxyl terminus of pICln, a protein involved in cellular volume regulation.
9556550 1998 pICln binds to a mammalian homolog of a yeast protein involved in regulation of cell morphology.
9533029 1997 Detailed map of a region commonly amplified at 11q13-->q14 in human breast carcinoma.
9359436 1997 Molecular cloning and expression of a chloride channel-associated protein pICln in human young red blood cells: association with actin.
8975725 1996 Chromosomal localization of the genes (CLNS1A and CLNS1B) coding for the swelling-dependent chloride channel ICln.
8579598 1996 The ubiquitously expressed pICln protein forms homomeric complexes in vitro.
7887970 1995 Molecular cloning of the human volume-sensitive chloride conductance regulatory protein, pICln, from ocular ciliary epithelium.