Property Summary

NCBI Gene PubMed Count 34
PubMed Score 51.55
PubTator Score 40.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
dermatomyositis 1.100 4.8e-03
intraductal papillary-mucinous adenoma (... 1.700 6.7e-04
intraductal papillary-mucinous carcinoma... 1.400 5.5e-03
lung cancer 1.400 1.1e-03
Multiple myeloma 2.004 7.8e-05
osteosarcoma 1.022 1.4e-02
ovarian cancer -1.100 6.3e-04
Waldenstrons macroglobulinemia 1.474 4.2e-03

Gene RIF (9)

AA Sequence

MSFLKSFPPPGPAEGLLRQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHALSRDR      1 - 70
SDCLGEHLYVMVNAKFEEESKEPVADEEEEDSDDDVEPITEFRFVPSDKSALEAMFTAMCECQALHPDPE     71 - 140
DEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQATLERLEGMLSQSVSSQYNMAGVRTEDS    141 - 210
IRDYEDGMEVDTTPTVAGQFEDADVDH                                               211 - 237
//

Text Mined References (49)

PMID Year Title