Property Summary

NCBI Gene PubMed Count 12
PubMed Score 449.74
PubTator Score 39.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
chronic lymphosyte leukemia 2.600 9.7e-09
interstitial cystitis 1.500 1.2e-02

Gene RIF (4)

AA Sequence

MNRQGNRKTTKEGSNDLKFQNFSLPKNRSWPRINSATGQYQRMNKPLLDWERNFAAVLDGAKGHSDDDYD      1 - 70
DPELRMEETWQSIKILPARPIKESEYADTHYFKVAMDTPLPLDTRTSISIGQPTWNTQTRLERVDKPISK     71 - 140
DVRSQNIKGDASVRKNKIPLPPPRPLITLPKKYQPLPPEPESSRPPLSQRHTFPEVQRMPSQISLRDLSE    141 - 210
VLEAEKVPHNQRKPESTHLLENQNTQEIPLAISSSSFTTSNHSVQNRDHRGGMQPCSPQRCQPPASCSPH    211 - 280
ENILPYKYTSWRPPFPKRSDRKDVQHNEWYIGEYSRQAVEEAFMKENKDGSFLVRDCSTKSKEEPYVLAV    281 - 350
FYENKVYNVKIRFLERNQQFALGTGLRGDEKFDSVEDIIEHYKNFPIILIDGKDKTGVHRKQCHLTQPLP    351 - 420
LTRHLLPL                                                                  421 - 428
//

Text Mined References (14)

PMID Year Title