Property Summary

NCBI Gene PubMed Count 17
PubMed Score 221.11
PubTator Score 71.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
osteosarcoma 2.658 8.2e-04
posterior fossa group B ependymoma -2.100 6.4e-08
cystic fibrosis 3.994 9.0e-08
autosomal dominant Emery-Dreifuss muscul... 1.291 5.9e-04
Atopic dermatitis -2.300 7.0e-04
adrenocortical carcinoma -2.185 1.0e-02
primary pancreatic ductal adenocarcinoma 1.258 3.7e-02
intraductal papillary-mucinous adenoma (... -2.000 5.3e-03
intraductal papillary-mucinous carcinoma... -2.500 6.6e-04
intraductal papillary-mucinous neoplasm ... -2.300 1.3e-02
breast carcinoma -1.700 5.2e-25
fibroadenoma -1.100 2.1e-02
group 4 medulloblastoma -2.300 6.6e-05
pilocytic astrocytoma -1.800 1.2e-03
aldosterone-producing adenoma -1.710 6.5e-03
psoriasis -1.500 3.0e-07
lung carcinoma -1.500 1.5e-18
Breast cancer -1.600 1.2e-06
ductal carcinoma in situ -2.500 6.9e-04
invasive ductal carcinoma -3.500 1.3e-04
ulcerative colitis 2.000 5.9e-04
ovarian cancer -3.300 1.5e-13

Pathway (1)

Protein-protein Interaction (6)

Gene RIF (8)

PMID Text
23460781 The key processes involved in intestinal epithelial development appear to be unaffected by wild type-CLMP or mutant-CLMP.
22992863 Coxsackievirus and adenovirus receptor gene expression is induced in esophageal cancer cells by the HDAC inhibitor trichostatin A.
22718816 The PDZ1 and PDZ3 domains of MAGI-1 regulate the eight-exon isoform of the CXADR-like membrane protein.
22155368 Loss-of-function mutations in CLMP cause congenital short bowel syndrome in human beings, likely by interfering with tight-junction formation, which disrupts intestinal development.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15563274 We identified ACAM (adipocyte adhesion molecule), a novel homologue of the CTX (cortical thymocyte marker in Xenopus) gene family, which may be the critical adhesion molecule in adipocyte differentiation and development of obesity.
14573622 CLMP is a novel cell-cell adhesion molecule and a new component of epithelial tight junctions.
12851705 ASAM, IGSF11, CXADR and ESAM are type I transmembrane proteins and members of the same IGSF superfamily.

AA Sequence

MSLLLLLLLVSYYVGTLGTHTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRH      1 - 70
VYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELE     71 - 140
GELTEGSDLTLQCESSSGTEPIVYYWQRIREKEGEDERLPPKSRIDYNHPGRVLLQNLTMSYSGLYQCTA    141 - 210
GNEAGKESCVVRVTVQYVQSIGMVAGAVTGIVAGALLIFLLVWLLIRRKDKERYEEEERPNEIREDAEAP    211 - 280
KARLVKPSSSSSGSRSSRSGSSSTRSTANSASRSQRTLSTDAAPQPGLATQAYSLVGPEVRGSEPKKVHH    281 - 350
ANLTKAETTPSMIPSQSRAFQTV                                                   351 - 373
//

Text Mined References (19)

PMID Year Title
23460781 2013 CLMP is essential for intestinal development, but does not play a key role in cellular processes involved in intestinal epithelial development.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23264731 2013 MTR120/KIAA1383, a novel microtubule-associated protein, promotes microtubule stability and ensures cytokinesis.
22992863 2012 Coxsackievirus and adenovirus receptor promotes antitumor activity of oncolytic adenovirus H101 in esophageal cancer.
22718816 2012 The PDZ1 and PDZ3 domains of MAGI-1 regulate the eight-exon isoform of the coxsackievirus and adenovirus receptor.
22155368 2012 CLMP is required for intestinal development, and loss-of-function mutations cause congenital short-bowel syndrome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19581412 2009 Quantitative proteomics identifies a Dab2/integrin module regulating cell migration.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17538635 2007 Positive and negative regulation of adenovirus infection by CAR-like soluble protein, CLSP.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15563274 2005 Identification of adipocyte adhesion molecule (ACAM), a novel CTX gene family, implicated in adipocyte maturation and development of obesity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14573622 2004 CLMP, a novel member of the CTX family and a new component of epithelial tight junctions.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12851705 2003 IGSF11 gene, frequently up-regulated in intestinal-type gastric cancer, encodes adhesion molecule homologous to CXADR, FLJ22415 and ESAM.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.