Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
psoriasis 6694 9.5e-61

AA Sequence

YVRAGKGNVTRRRKKTHLGNDDGKKEAQEKM                                            71 - 101

Text Mined References (1)

PMID Year Title