Property Summary

Ligand Count 27
NCBI Gene PubMed Count 10
PubMed Score 7.42
PubTator Score 7.23

Knowledge Summary

Patent (1,703)

Expression

  Differential Expression (12)

Disease log2 FC p
Breast cancer -1.200 5.1e-06
cystic fibrosis -1.132 9.2e-03
invasive ductal carcinoma -1.100 2.5e-03
medulloblastoma, large-cell -1.200 2.6e-03
Multiple myeloma 1.100 3.7e-03
non-small cell lung cancer -1.069 6.1e-15
osteosarcoma -1.274 1.3e-04
ovarian cancer -2.600 1.6e-09
Pick disease -1.100 2.6e-04
pituitary cancer 1.200 8.1e-03
psoriasis 1.400 6.2e-08
tuberculosis -1.400 6.2e-07

Gene RIF (2)

AA Sequence

MRHSKRTHCPDWDSRESWGHESYRGSHKRKRRSHSSTQENRHCKPHHQFKESDCHYLEARSLNERDYRDR      1 - 70
RYVDEYRNDYCEGYVPRHYHRDIESGYRIHCSKSSVRSRRSSPKRKRNRHCSSHQSRSKSHRRKRSRSIE     71 - 140
DDEEGHLICQSGDVLRARYEIVDTLGEGAFGKVVECIDHGMDGMHVAVKIVKNVGRYREAARSEIQVLEH    141 - 210
LNSTDPNSVFRCVQMLEWFDHHGHVCIVFELLGLSTYDFIKENSFLPFQIDHIRQMAYQICQSINFLHHN    211 - 280
KLTHTDLKPENILFVKSDYVVKYNSKMKRDERTLKNTDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVIL    281 - 350
ALGWSQPCDVWSIGCILIEYYLGFTVFQTHDSKEHLAMMERILGPIPQHMIQKTRKRKYFHHNQLDWDEH    351 - 420
SSAGRYVRRRCKPLKEFMLCHDEEHEKLFDLVRRMLEYDPTQRITLDEALQHPFFDLLKKK             421 - 481
//

Text Mined References (15)

PMID Year Title