Property Summary

NCBI Gene PubMed Count 26
PubMed Score 28.43
PubTator Score 8.39

Knowledge Summary

Patent (2,501)

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 1.2e-07
osteosarcoma 7933 1.2e-07

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.342 1.2e-07
ovarian cancer 1.100 1.2e-07

 GWAS Trait (1)

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
2710 other 28 / 0 / 0 Kinase Inhibition Profile Study on Inhibitors of CDC-like Kinase 4
504428 confirmatory 25 / 0 / 40 Kinase Inhibition Study on Inhibitors of CDC-like Kinase 3 (Reaction Biology data)
624049 confirmatory 9 / 0 / 24 Reaction Biology data for inhibitors of CLK3: Probe SAR

Gene RIF (2)

PMID Text
19426592 regulated but the expression of CDK9, CDC20 and CLK3 was down- regulated in azoospermic testes.
19168442 Cdc2-like kinases and DNA topoisomerase I regulate alternative splicing of tissue factor in human endothelial cells.

AA Sequence

MPVLSARRRELADHAGSGRRSGPSPTARSGPHLSALRAQPARAAHLSGRGTYVRRDTAGGGPGQARPLGP      1 - 70
PGTSLLGRGARRSGEGWCPGAFESGARAARPPSRVEPRLATAASREGAGLPRAEVAAGSGRGARSGEWGL     71 - 140
AAAGAWETMHHCKRYRSPEPDPYLSYRWKRRRSYSREHEGRLRYPSRREPPPRRSRSRSHDRLPYQRRYR    141 - 210
ERRDSDTYRCEERSPSFGEDYYGPSRSRHRRRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRS    211 - 280
SRSVEDDKEGHLVCRIGDWLQERYEIVGNLGEGTFGKVVECLDHARGKSQVALKIIRNVGKYREAARLEI    281 - 350
NVLKKIKEKDKENKFLCVLMSDWFNFHGHMCIAFELLGKNTFEFLKENNFQPYPLPHVRHMAYQLCHALR    351 - 420
FLHENQLTHTDLKPENILFVNSEFETLYNEHKSCEEKSVKNTSIRVADFGSATFDHEHHTTIVATRHYRP    421 - 490
PEVILELGWAQPCDVWSIGCILFEYYRGFTLFQTHENREHLVMMEKILGPIPSHMIHRTRKQKYFYKGGL    491 - 560
VWDENSSDGRYVKENCKPLKSYMLQDSLEHVQLFDLMRRMLEFDPAQRITLAEALLHPFFAGLTPEERSF    561 - 630
HTSRNPSR                                                                  631 - 638
//

Text Mined References (35)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25281661 2015 Genome-wide association study identified SNP on 15q24 associated with bladder cancer risk in Japanese population.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21615147 2011 Leucettines, a class of potent inhibitors of cdc2-like kinases and dual specificity, tyrosine phosphorylation regulated kinases derived from the marine sponge leucettamine B: modulation of alternative pre-RNA splicing.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19426592 2009 [Expression of cell cycle molecules in human azoospermic testes].
19168442 2009 Cdc2-like kinases and DNA topoisomerase I regulate alternative splicing of tissue factor in human endothelial cells.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17192257 2007 Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
14759258 2004 An unappreciated role for RNA surveillance.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9856501 1998 Chromosomal mapping of three human LAMMER protein-kinase-encoding genes.
9637771 1998 The Clk2 and Clk3 dual-specificity protein kinases regulate the intranuclear distribution of SR proteins and influence pre-mRNA splicing.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7990150 1994 Characterization by cDNA cloning of two new human protein kinases. Evidence by sequence comparison of a new family of mammalian protein kinases.