Property Summary

NCBI Gene PubMed Count 62
PubMed Score 322.09
PubTator Score 380.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Rheumatoid Arthritis 1.200 4.9e-02
esophageal adenocarcinoma -1.300 2.8e-02
osteosarcoma 2.191 2.6e-06
periodontitis -1.100 1.8e-22
glioblastoma -1.300 3.1e-04
medulloblastoma, large-cell -1.800 5.3e-04
hereditary spastic paraplegia -1.570 1.7e-03
lung cancer -1.600 8.7e-03
adult high grade glioma -1.100 3.7e-02
posterior fossa group B ependymoma -1.200 2.0e-04
sonic hedgehog group medulloblastoma -1.200 8.9e-03
aldosterone-producing adenoma -1.043 4.2e-02
psoriasis -1.400 9.1e-07
spina bifida -1.194 3.0e-02
Pick disease 2.200 1.4e-04
progressive supranuclear palsy 1.500 4.0e-02
Breast cancer -1.800 3.2e-25
gastric carcinoma 1.100 7.8e-03
ovarian cancer 1.600 1.9e-03

Gene RIF (36)

PMID Text
27199431 single-molecule fluorescence microscopy showed that the microtubule plus-end-associated protein CLIP-170 binds tightly to formins to accelerate actin filament elongation.
26506308 We show that AMPH-1/BIN1 binds to nesprin and actin, as well as to the microtubule-binding protein CLIP170 in both species. We propose that BIN1 has a direct and evolutionarily conserved role in nuclear positioning, altered in myopathies.
26504169 herpesvirus particles are absolutely dependent on CLIP-170-mediated capture to initiate transport in primary human cells.
26231764 CLIP-170 tethers kinetochores to microtubule ends against the dynein-mediated poleward force to slide kinetochores along microtubules
25972084 Restin inhibits epithelial-mesenchymal transition and tumor metastasis by controlling the expression of the tumor metastasis suppressor mir-200a/b via association with p73.
25413345 We find that LRRK1-mediated phosphorylation of CLIP-170 causes the accumulation of p150(Glued) (also known as DCTN1) a subunit of dynactin, at microtubule plus ends, thereby facilitating the migration of EGFR-containing endosomes.
24777477 Data suggest that CLIP-170 acts as a novel recruiter and spatial regulator of PLK1 at kinetochores during early mitosis, promoting K-fiber stability and chromosome alignment for error-free chromosome segregation.
24569606 A defect in the CLIP1 gene (CLIP-170) can cause autosomal recessive intellectual disability.
24530770 siRNA-mediated knockdown of the cytoplasmic linker protein compromised the assembly and branching of capillary-like blood vessels and neovascularization in vivo. It was critical for the motility abilities of HUVECs through its actions on cell polarity.
24474193 HDAC6 interacts with cytoplasmic linker protein 170 (CLIP-170) and that these two proteins function together to stimulate the migration of pancreatic cancer cells.
24451569 CLIP-170 phosphorylation by Plk1 regulates proper chromosome alignment
23549612 Depletion of CLIP-170 significantly impaired vascular endothelial tube formation and sprouting in vitro and inhibited breast tumor growth in mice by decreasing tumor vascularization.
22543185 We further demonstrate that this binding was prevented when the C-terminal tyrosine of EB1 was absent in the peptidic probes.
22424550 results suggest that EB1 and ClipCG12 act cooperatively to regulate microtubule dynamics (CLIP-170)
22119847 End-binding proteins interact with the CAP-Gly domains of CLIP-170 and p150(glued).
21989536 These results demonstrate that CLIP-170 mediates paclitaxel sensitivity in breast cancer via a microtubule-dependent mechanism.
20664522 Herein, the authors have identified polo-like kinase 1 (Plk1) and casein kinase 2 (CK2) as two kinases of CLIP-170 and mapped S195 and S1318 as their respective phosphorylation sites.
19687009 Cdc2-mediated phosphorylation of CLIP-170 is essential for the normal function of this protein during cell cycle progression
19126680 EB1 is both necessary and sufficient to mediate microtubule plus-end tracking by CLIP-170.
19020519 these results suggest that complexes of dynein, Lis1 and CLIP-170 crosslink and slide microtubules within the spindle, thereby producing an inward force that pulls centrosomes together.
19004523 Amphiphysin 2/BIN1 participates in the tubulation of traffic intermediates and intracellular organelles first via its intrinsic tubulating potential and second via its ability to bind CLIP-170 and microtubules.
18622020 CLIP-170 was expressed in differentiated keratinocytes, first at the periphery of the nucleus then with a granular cytoplasmic labeling evocative of lamellar bodies
18237546 The results suggest that promotion of lamellipodia formation and invasion by HGF or serum requires PI3K-dependent release of IQGAP1 and kinesin from Rac1-CLIP-170 complex.
17889670 Crystal structures of the tubulin binding domains of XMAP215 (yeast Stu2p and Drosophila Msps), EB1 (yeast Bim1p and human EB1), and CLIP-170 (human), which reveal diverse tubulin binding interfaces, are reported.
17828277 Data use the complex formed between the CAP-Gly domain of p150(glued) and the C-terminal zinc knuckle of CLIP170 as a model system to explore the structure-function relationship of CAP-Gly-mediated protein interactions.
17563362 A structural basis for tubulin recognition by CLIP-170 and its autoinhibition is provided.
16772339 The function of CLIP-170 in membrane trafficking is not associated with plus-end localization.
16574066 STAT-1alpha plays an important role in the atRA-induced transcriptional up-regulation of restin
16362039 CLIP-170 facilitates the formation of kinetochore-microtubule attachments, possibly through direct capture of microtubules at the kinetochore.
16120651 these data explain observations that CLIP-170 localizes to newly polymerized microtubules in vitro but cannot track microtubule plus-ends in vitro. These observations have implications for the functions of CLIP-170 in regulating microtubule dynamics
15862147 The restin gene was amplified from retinoic acid-treated promyelocytic cell line HL-60 by RT-PCR and cloned into a prokaryotic expression vector.
12833147 neogenin and restin have roles in proproliferation/survival action on ovarian cancer cells
12433698 expressed at high levels in monocyte-derived dendritic cells and IL-4 + CD40L-activated B cells and is involved in the trafficking of macropinosomes to the cytoskeleton, a crucial step in antigen presentation
12110184 Rac1 and Cdc42 capture microtubules through IQGAP1 and CLIP-170.
11966772 The cytoplasmic linker protein CLIP-170 is a human autoantigen
11940666 LIS1, CLIP-170's key to the dynein/dynactin pathway

AA Sequence

MSMLKPSGLKAPTKILKPGSTALKTPTAVVAPVEKTISSEKASSTPSSETQEEFVDDFRVGERVWVNGNK      1 - 70
PGFIQFLGETQFAPGQWAGIVLDEPIGKNDGSVAGVRYFQCEPLKGIFTRPSKLTRKVQAEDEANGLQTT     71 - 140
PASRATSPLCTSTASMVSSSPSTPSNIPQKPSQPAAKEPSATPPISNLTKTASESISNLSEAGSIKKGER    141 - 210
ELKIGDRVLVGGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTK    211 - 280
IGFPSTTPAKAKANAVRRVMATTSASLKRSPSASSLSSMSSVASSVSSRPSRTGLLTETSSRYARKISGT    281 - 350
TALQEALKEKQQHIEQLLAERDLERAEVAKATSHVGEIEQELALARDGHDQHVLELEAKMDQLRTMVEAA    351 - 420
DREKVELLNQLEEEKRKVEDLQFRVEEESITKGDLEQKSQISEDPENTQTKLEHARIKELEQSLLFEKTK    421 - 490
ADKLQRELEDTRVATVSEKSRIMELEKDLALRVQEVAELRRRLESNKPAGDVDMSLSLLQEISSLQEKLE    491 - 560
VTRTDHQREITSLKEHFGAREETHQKEIKALYTATEKLSKENESLKSKLEHANKENSDVIALWKSKLETA    561 - 630
IASHQQAMEELKVSFSKGLGTETAEFAELKTQIEKMRLDYQHEIENLQNQQDSERAAHAKEMEALRAKLM    631 - 700
KVIKEKENSLEAIRSKLDKAEDQHLVEMEDTLNKLQEAEIKVKELEVLQAKCNEQTKVIDNFTSQLKATE    701 - 770
EKLLDLDALRKASSEGKSEMKKLRQQLEAAEKQIKHLEIEKNAESSKASSITRELQGRELKLTNLQENLS    771 - 840
EVSQVKETLEKELQILKEKFAEASEEAVSVQRSMQETVNKLHQKEEQFNMLSSDLEKLRENLADMEAKFR    841 - 910
EKDEREEQLIKAKEKLENDIAEIMKMSGDNSSQLTKMNDELRLKERDVEELQLKLTKANENASFLQKSIE    911 - 980
DMTVKAEQSQQEAAKKHEEEKKELERKLSDLEKKMETSHNQCQELKARYERATSETKTKHEEILQNLQKT    981 - 1050
LLDTEDKLKGAREENSGLLQELEELRKQADKAKAAQTAEDAMQIMEQMTKEKTETLASLEDTKQTNAKLQ   1051 - 1120
NELDTLKENNLKNVEELNKSKELLTVENQKMEEFRKEIETLKQAAAQKSQQLSALQEENVKLAEELGRSR   1121 - 1190
DEVTSHQKLEEERSVLNNQLLEMKKRESKFIKDADEEKASLQKSISITSALLTEKDAELEKLRNEVTVLR   1191 - 1260
GENASAKSLHSVVQTLESDKVKLELKVKNLELQLKENKRQLSSSSGNTDTQADEDERAQESQIDFLNSVI   1261 - 1330
VDLQRKNQDLKMKVEMMSEAALNGNGDDLNNYDSDDQEKQSKKKPRLFCDICDCFDLHDTEDCPTQAQMS   1331 - 1400
EDPPHSTHHGSRGEERPYCEICEMFGHWATNCNDDETF                                   1401 - 1438
//

Text Mined References (71)

PMID Year Title
27199431 2016 Accelerated actin filament polymerization from microtubule plus ends.
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26506308 2015 Amphiphysin 2 Orchestrates Nucleus Positioning and Shape by Linking the Nuclear Envelope to the Actin and Microtubule Cytoskeleton.
26504169 2015 Microtubule plus end-associated CLIP-170 initiates HSV-1 retrograde transport in primary human cells.
26231764 2015 CLIP-170 tethers kinetochores to microtubule plus ends against poleward force by dynein for stable kinetochore-microtubule attachment.
25972084 2015 Restin suppressed epithelial-mesenchymal transition and tumor metastasis in breast cancer cells through upregulating mir-200a/b expression via association with p73.
25413345 2015 LRRK1-phosphorylated CLIP-170 regulates EGFR trafficking by recruiting p150Glued to microtubule plus ends.
24777477 2014 CLIP-170 recruits PLK1 to kinetochores during early mitosis for chromosome alignment.
24569606 2015 A defect in the CLIP1 gene (CLIP-170) can cause autosomal recessive intellectual disability.
24530770 2014 Identification of a cytoplasmic linker protein as a potential target for neovascularization.
24474193 2014 Histone deacetylase 6 and cytoplasmic linker protein 170 function together to regulate the motility of pancreatic cancer cells.
24451569 2014 Plk1 phosphorylates CLIP-170 and regulates its binding to microtubules for chromosome alignment.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23549612 2013 Regulation of tumor angiogenesis by the microtubule-binding protein CLIP-170.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22543185 2012 Tyrosine-dependent capture of CAP-Gly domain-containing proteins in complex mixture by EB1 C-terminal peptidic probes.
22424550 2012 Cooperative stabilization of microtubule dynamics by EB1 and CLIP-170 involves displacement of stably bound P(i) at microtubule ends.
22119847 2012 Interaction of mammalian end binding proteins with CAP-Gly domains of CLIP-170 and p150(glued).
21989536 2012 Microtubule-binding protein CLIP-170 is a mediator of paclitaxel sensitivity.
21646404 2011 SLAIN2 links microtubule plus end-tracking proteins and controls microtubule growth in interphase.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
20679239 2010 Polo-like kinase 1 phosphorylation of p150Glued facilitates nuclear envelope breakdown during prophase.
20664522 2010 Phosphorylation of CLIP-170 by Plk1 and CK2 promotes timely formation of kinetochore-microtubule attachments.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19687009 2009 Cdc2-mediated phosphorylation of CLIP-170 is essential for its inhibition of centrosome reduplication.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19126680 2009 Microtubule plus-end tracking by CLIP-170 requires EB1.
19020519 2008 Dynein, Lis1 and CLIP-170 counteract Eg5-dependent centrosome separation during bipolar spindle assembly.
19004523 2009 The membrane-tubulating potential of amphiphysin 2/BIN1 is dependent on the microtubule-binding cytoplasmic linker protein 170 (CLIP-170).
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18622020 2008 Lamellar bodies of human epidermis: proteomics characterization by high throughput mass spectrometry and possible involvement of CLIP-170 in their trafficking/secretion.
18237546 2008 Regulation of lamellipodia formation and cell invasion by CLIP-170 in invasive human breast cancer cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17889670 2007 Structural basis of microtubule plus end tracking by XMAP215, CLIP-170, and EB1.
17828277 2007 Structure-function relationship of CAP-Gly domains.
17828275 2007 CLIP170 autoinhibition mimics intermolecular interactions with p150Glued or EB1.
17563362 2007 Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16772339 2006 Microtubule plus-end loading of p150(Glued) is mediated by EB1 and CLIP-170 but is not required for intracellular membrane traffic in mammalian cells.
16574066 2006 Transcriptional up-regulation of restin by all-trans retinoic acid through STAT1 in cancer cell differentiation process.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16455083 2006 Microtubule binding proteins CLIP-170, EB1, and p150Glued form distinct plus-end complexes.
16362039 2006 CLIP-170 facilitates the formation of kinetochore-microtubule attachments.
16120651 2005 Interactions between CLIP-170, tubulin, and microtubules: implications for the mechanism of Clip-170 plus-end tracking behavior.
16083285 Global phosphoproteome of HT-29 human colon adenocarcinoma cells.
15928712 2005 CLIPs and CLASPs and cellular dynamics.
15862147 2005 [Cloning and expression of a novel gene restin and preparation of antisera against the recombinant restin].
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15262990 2004 CLIPR-59 is a lipid raft-associated protein containing a cytoskeleton-associated protein glycine-rich domain (CAP-Gly) that perturbs microtubule dynamics.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12833147 2003 Profiling follicle stimulating hormone-induced gene expression changes in normal and malignant human ovarian surface epithelial cells.
12789661 2003 CLIP-170 interacts with dynactin complex and the APC-binding protein EB1 by different mechanisms.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12433698 2002 Hodgkin and Reed-Sternberg cell-associated autoantigen CLIP-170/restin is a marker for dendritic cells and is involved in the trafficking of macropinosomes to the cytoskeleton, supporting a function-based concept of Hodgkin and Reed-Sternberg cells.
12231510 2002 The FKBP12-rapamycin-associated protein (FRAP) is a CLIP-170 kinase.
11966772 2002 The cytoplasmic linker protein CLIP-170 is a human autoantigen.
11940666 2002 LIS1, CLIP-170's key to the dynein/dynactin pathway.
11290329 2001 Clasps are CLIP-115 and -170 associating proteins involved in the regional regulation of microtubule dynamics in motile fibroblasts.
10052454 1999 CLIP-170 highlights growing microtubule ends in vivo.
9784600 1998 Identification and expression of two novel CLIP-170/Restin isoforms expressed predominantly in muscle.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8222754 1994 Localization of the gene (RSN) coding for restin, a marker for Reed-Sternberg cells in Hodgkin's disease, to human chromosome band 12q24.3 and YAC cloning of the locus.
7983157 1994 Molecular characterization of two functional domains of CLIP-170 in vivo.
1600942 1992 Restin: a novel intermediate filament-associated protein highly expressed in the Reed-Sternberg cells of Hodgkin's disease.
1356075 1992 CLIP-170 links endocytic vesicles to microtubules.