Property Summary

NCBI Gene PubMed Count 31
PubMed Score 179.42
PubTator Score 44.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma 1.700 5.7e-04
atypical teratoid / rhabdoid tumor 1.200 3.4e-06
Breast cancer -1.100 1.4e-06
cystic fibrosis and chronic rhinosinusit... -1.502 4.1e-02
ependymoma 1.100 1.3e-03
glioblastoma 1.200 4.1e-03
intraductal papillary-mucinous adenoma (... 1.200 7.1e-03
intraductal papillary-mucinous neoplasm ... 1.500 3.4e-02
lung adenocarcinoma 1.104 3.9e-06
medulloblastoma, large-cell 1.300 8.9e-05
Multiple myeloma 1.183 1.1e-02
osteosarcoma 1.649 3.7e-07
ovarian cancer 1.400 3.3e-03
psoriasis 1.200 3.4e-05
Waldenstrons macroglobulinemia 1.166 5.1e-03

Gene RIF (17)

AA Sequence

MLNMWKVRELVDKATNVVMNYSEIESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPELMNMLWSRMLK      1 - 70
DNKKNWRRVYKSLLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDEHGKDQGINIRQKVKELVEFAQ     71 - 140
DDDRLREERKKAKKNKDKYVGVSSDSVGGFRYSERYDPEPKSKWDEEWDKNKSAFPFSDKLGELSDKIGS    141 - 210
TIDDTISKFRRKDREDSPERCSDSDEEKKARRGRSPKGEFKDEEETVTTKHIHITQATETTTTRHKRTAN    211 - 280
PSKTIDLGAAAHYTGDKASPDQNASTHTPQSSVKTSVPSSKSSGDLVDLFDGTSQSTGGSADLFGGFADF    281 - 350
GSAAASGSFPSQVTATSGNGDFGDWSAFNQAPSGPVASSGEFFGSASQPAVELVSGSQSALGPPPAASNS    351 - 420
SDLFDLMGSSQATMTSSQSMNFSMMSTNTVGLGLPMSRSQNTDMVQKSVSKTLPSTWSDPSVNISLDNLL    421 - 490
PGMQPSKPQQPSLNTMIQQQNMQQPMNVMTQSFGAVNLSSPSNMLPVRPQTNALIGGPMPMSMPNVMTGT    491 - 560
MGMAPLGNTPMMNQSMMGMNMNIGMSAAGMGLTGTMGMGMPNIAMTSGTVQPKQDAFANFANFSK         561 - 625
//

Text Mined References (43)

PMID Year Title