Property Summary

NCBI Gene PubMed Count 28
PubMed Score 9.53
PubTator Score 10.31

Knowledge Summary

Patent (1,412)

Expression

  Differential Expression (32)

Disease log2 FC p
gastric cancer 1.500 6.9e-04
hepatocellular carcinoma 1.100 1.9e-03
malignant mesothelioma 3.800 2.2e-09
astrocytic glioma -1.900 3.3e-03
ependymoma -2.000 7.7e-03
oligodendroglioma -1.500 9.5e-03
psoriasis -1.400 1.6e-08
osteosarcoma 1.612 3.4e-02
glioblastoma -2.000 3.3e-04
medulloblastoma -2.100 1.4e-06
atypical teratoid / rhabdoid tumor -1.900 3.1e-04
medulloblastoma, large-cell -2.500 2.6e-05
primitive neuroectodermal tumor -1.800 9.9e-05
Duchenne muscular dystrophy -1.025 2.7e-03
hereditary spastic paraplegia -1.134 5.6e-03
tuberculosis and treatment for 6 months -2.200 1.2e-05
non-small cell lung cancer -5.513 1.6e-37
intraductal papillary-mucinous adenoma (... -1.600 1.9e-02
intraductal papillary-mucinous neoplasm ... 2.100 4.4e-02
lung cancer -4.800 5.3e-06
breast carcinoma -1.500 1.2e-04
fibroadenoma -1.600 2.3e-02
cystic fibrosis -1.300 9.7e-04
lung adenocarcinoma -4.500 9.5e-17
pediatric high grade glioma -1.600 3.3e-04
pilocytic astrocytoma -1.900 4.3e-08
nasopharyngeal carcinoma -1.300 1.4e-03
lung carcinoma -3.900 8.8e-37
ductal carcinoma in situ -2.200 1.1e-04
invasive ductal carcinoma -2.500 6.2e-04
ovarian cancer -3.300 1.7e-06
pituitary cancer -1.900 3.5e-05

Gene RIF (10)

PMID Text
26135398 EZR, CLIC5 and PODXL are overexpressed in hepatocellular carcinoma and may have a role in cell migration and invasiveness
25344252 The mechanism of CLIC5A action involves clustered plasma membrane phosphatidylinositol 4,5-bisphosphate accumulation, in turn facilitating ezrin activation and actin-dependent cell surface remodeling.
24781754 CLIC5 is a novel gene involved in progressive hearing impairment, vestibular and possibly mild renal dysfunction.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20335315 CLIC5A colocalizes with ezrin and podocalyxin in podocytes and is required for the development/maintenance of the proper glomerular endothelial cell and podocyte architecture.
18676988 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18028448 Data showed that CLIC1 and CLIC5, but not CLIC4, were strongly and reversibly inhibited (or inactivated) by F-actin.
17492382 CLIC5 was demonstrated in cultured lymphoblasts.
15184393 CLIC-5A has a role as a chloride channel in vitro and binds to cortical actin cytoskeleton
12163479 association with Golgi apparatus AKAP350

AA Sequence

MNDEDYSTIYDTIQNERTYEVPDQPEENESPHYDDVHEYLRPENDLYATQLNTHEYDFVSVYTIKGEETS      1 - 70
LASVQSEDRGYLLPDEIYSELQEAHPGEPQEDRGISMEGLYSSTQDQQLCAAELQENGSVMKEDLPSPSS     71 - 140
FTIQHSKAFSTTKYSCYSDAEGLEEKEGAHMNPEIYLFVKAGIDGESIGNCPFSQRLFMILWLKGVVFNV    141 - 210
TTVDLKRKPADLHNLAPGTHPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFSK    211 - 280
FSAYIKNTKQQNNAALERGLTKALKKLDDYLNTPLPEEIDANTCGEDKGSRRKFLDGDELTLADCNLLPK    281 - 350
LHVVKIVAKKYRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS              351 - 410
//

Text Mined References (28)

PMID Year Title
26135398 2015 Co-Expression of Ezrin-CLIC5-Podocalyxin Is Associated with Migration and Invasiveness in Hepatocellular Carcinoma.
25344252 2014 Clustered PI(4,5)P? accumulation and ezrin phosphorylation in response to CLIC5A.
24781754 2015 Progressive hearing loss and vestibular dysfunction caused by a homozygous nonsense mutation in CLIC5.
23326517 2013 Insights into the genetic architecture of early stage age-related macular degeneration: a genome-wide association study meta-analysis.
22699663 2012 Genome-wide association study of periodontal pathogen colonization.
20946665 2010 A multigene predictor of metastatic outcome in early stage hormone receptor-negative and triple-negative breast cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20335315 2010 CLIC5A, a component of the ezrin-podocalyxin complex in glomeruli, is a determinant of podocyte integrity.
20055760 2010 The CLIC5 (chloride intracellular channel 5) involved in C2C12 myoblasts proliferation and differentiation.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18676988 2008 A high-density association screen of 155 ion transport genes for involvement with common migraine.
18028448 2007 Functional reconstitution of mammalian 'chloride intracellular channels' CLIC1, CLIC4 and CLIC5 reveals differential regulation by cytoskeletal actin.
17492382 2007 Gene transcript amplification from cell lysates in continuous-flow microfluidic devices.
17021174 2006 The chloride intracellular channel protein CLIC5 is expressed at high levels in hair cell stereocilia and is essential for normal inner ear function.
16831863 2006 c-Src control of chloride channel support for osteoclast HCl transport and bone resorption.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15184393 2004 CLIC-5A functions as a chloride channel in vitro and associates with the cortical actin cytoskeleton in vitro and in vivo.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12200217 2002 Identification and mutational analysis of candidate genes for juvenile myoclonic epilepsy on 6p11-p12: LRRC1, GCLC, KIAA0057 and CLIC5.
12163479 2002 AKAP350 at the Golgi apparatus. II. Association of AKAP350 with a novel chloride intracellular channel (CLIC) family member.
10793131 2000 Identification of a novel member of the chloride intracellular channel gene family (CLIC5) that associates with the actin cytoskeleton of placental microvilli.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.