Property Summary

NCBI Gene PubMed Count 50
PubMed Score 65.24
PubTator Score 48.29

Knowledge Summary

Patent (7,308)

TINX Plot

  Disease (3)

Expression

  Differential Expression (34)

Disease log2 FC p
Multiple myeloma 1.024 3.5e-02
malignant mesothelioma -1.800 6.1e-07
astrocytic glioma 2.000 2.4e-03
posterior fossa group A ependymoma 2.200 2.0e-06
oligodendroglioma 1.700 1.3e-02
glioblastoma 3.500 5.1e-06
osteosarcoma 3.176 3.4e-05
atypical teratoid / rhabdoid tumor 1.600 4.0e-04
medulloblastoma 1.900 3.1e-03
medulloblastoma, large-cell 2.700 2.0e-05
primitive neuroectodermal tumor 1.200 7.0e-03
Duchenne muscular dystrophy 2.202 1.5e-09
limb girdle muscular dystrophy 2B 1.723 4.5e-05
autosomal dominant Emery-Dreifuss muscul... 1.472 4.3e-03
Becker muscular dystrophy 1.873 2.3e-04
hereditary spastic paraplegia -1.006 3.0e-02
juvenile dermatomyositis 1.756 6.7e-11
Amyotrophic Lateral Sclerosis 1.019 7.2e-04
tuberculosis and treatment for 3 months -1.300 1.3e-04
primary pancreatic ductal adenocarcinoma 1.167 3.8e-02
lung cancer -1.500 8.1e-05
colon cancer -1.100 1.6e-03
Breast cancer 2.600 3.4e-02
pediatric high grade glioma 2.500 5.1e-05
pilocytic astrocytoma 1.700 1.6e-03
aldosterone-producing adenoma -1.470 2.2e-02
lung adenocarcinoma -1.100 1.7e-09
Polycystic Ovary Syndrome -1.746 4.9e-02
lung carcinoma -1.300 9.2e-15
progressive supranuclear palsy -1.700 5.3e-03
pterygium 1.100 1.5e-02
ovarian cancer -2.500 2.5e-06
Down syndrome 2.000 1.3e-03
pancreatic cancer 1.200 2.3e-02

Pathway (1)

Protein-protein Interaction (5)

Gene RIF (26)

PMID Text
26445368 in malignant pleural mesothelioma, the gene expressions of CLIC3 and CLIC4 were significantly increased compared to controls
25546839 CLIC1 and CLIC4 are overexpressed in specific tumor types or their corresponding stroma and change localization and function from hydrophilic cytosolic to integral transmembrane proteins. (Review)
25344254 CLIC4 knockdown decreases cell-matrix adhesion, cell spreading and integrin signaling, whereas it increases cell motility.
24916695 CLIC4, ERp29, and Smac/DIABLO integrated into a novel panel based on cancer stem-like cells in association with metastasis stratify the prognostic risks of colorectal cancer.
24503951 Increased CLIC4 expression is an early manifestation and mediator of endothelial dysfunction in pulmonary hypertension.
24503901 This study investigated the proteome modulated by oncogenic KRAS in immortalized airway epithelial cells.
23792823 In addition to CLIC1 and TPM1, which were the proteins initially discovered in a xenograft mouse model, CLIC4, TPM2, TPM3, and TPM4 were present in ovarian cancer patient sera at significantly elevated levels compared with controls.
23416981 CLIC4 increases tumor cell migration and invasion in a TGF-beta-dependent manner.
23380911 Our data indicate that CLIC4 protein may be a key element in the apoptotic response to oxidative stress.
22761775 These results demonstrate that CLIC4 nuclear translocation is an integral part of the cellular response to starvation.
22387366 Reduced CLIC4 expression and nuclear residence detected in cancer cells is associated with the altered redox state of tumor cells and the absence of detectable nuclear CLIC4 in cancers contributes to TGF-beta resistance and enhances tumor development.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20374090 CLIC4 may not be responsible for benign familial infantile seizures (BFIS) in a Chinese family affected with BFIS.
19776349 Data suggest that CLIC4 is regulated by RhoA to be targeted to the plasma membrane, where it may function not as an inducible chloride channel but rather by displaying Cys-dependent transferase activity toward a yet unknown substrate.
19713532 S100A4 and bone morphogenetic protein-2 codependently induce vascular smooth muscle cell migration via phospho-extracellular signal-regulated kinase and chloride intracellular channel 4.
19639201 ROS-initiated CLIC4 up-regulation is required for TGF-beta1-induced fibroblast-to-myofibroblast transdifferentiaton in ovarian cancer.
19247789 CLIC4 functions to promote endothelial cell proliferation and to regulate endothelial morphogenesis, and is thus involved in multiple steps of in vitro angiogenesis.
18028448 Data showed that CLIC1 and CLIC5, but not CLIC4, were strongly and reversibly inhibited (or inactivated) by F-actin.
17636002 Nuclear CLIC4, possibly by altering the Cl(-) and pH of the nucleus, contributes to cell cycle arrest and the specific gene expression program associated with keratinocyte terminal differentiation.
17200346 CLIC4 in tumor stroma has a role in myofibroblast conversion in human neoplasms
16842122 preliminary crystallographic analysis
16316993 up-regulation of mitochondrial CLIC4, together with a reduction in Bcl-2 and Bcl-xL, sensitizes Myc-expressing cells to the proapoptotic action of Bax.
16239224 subcellular localization of CLIC4 in endothelial cells was dependent on whether cells were engaged in proliferation or tube formation
14569596 CLIC4 has alternate cellular functions that are distinct from their proposed roles as chloride channels
12163372 CLIC4 is differentially regulated in fibroblasts and its expression contributes to a myofibroblast phenotype

AA Sequence

MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLA      1 - 70
PGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEAL     71 - 140
ERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDI    141 - 210
PKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK                               211 - 253
//

Text Mined References (60)

PMID Year Title
26445368 2015 Transcriptional over-expression of chloride intracellular channels 3 and 4 in malignant pleural mesothelioma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25546839 2015 Chloride channels in cancer: Focus on chloride intracellular channel 1 and 4 (CLIC1 AND CLIC4) proteins in tumor development and as novel therapeutic targets.
25344254 2014 CLIC4 regulates cell adhesion and ?1 integrin trafficking.
24916695 2014 CLIC4, ERp29, and Smac/DIABLO derived from metastatic cancer stem-like cells stratify prognostic risks of colorectal cancer.
24503951 2014 Aberrant chloride intracellular channel 4 expression contributes to endothelial dysfunction in pulmonary arterial hypertension.
24503901 2014 Proteome analysis for downstream targets of oncogenic KRAS--the potential participation of CLIC4 in carcinogenesis in the lung.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23792823 2013 Protein isoform-specific validation defines multiple chloride intracellular channel and tropomyosin isoforms as serological biomarkers of ovarian cancer.
23416981 2014 CLIC4 regulates TGF-?-dependent myofibroblast differentiation to produce a cancer stroma.
23380911 2013 Suppression of CLIC4/mtCLIC enhances hydrogen peroxide-induced apoptosis in C6 glioma cells.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22761775 2012 Inhibition of CLIC4 enhances autophagy and triggers mitochondrial and ER stress-induced apoptosis in human glioma U251 cells under starvation.
22387366 2012 CLIC4 is a tumor suppressor for cutaneous squamous cell cancer.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20374090 2010 Mutation detection in candidate genes for benign familial infantile seizures on a novel locus.
19776349 2009 Spatiotemporal regulation of chloride intracellular channel protein CLIC4 by RhoA.
19713532 2009 S100A4 and bone morphogenetic protein-2 codependently induce vascular smooth muscle cell migration via phospho-extracellular signal-regulated kinase and chloride intracellular channel 4.
19639201 2009 CLIC4 mediates TGF-beta1-induced fibroblast-to-myofibroblast transdifferentiation in ovarian cancer.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19247789 2009 Chloride intracellular channel 4 is involved in endothelial proliferation and morphogenesis in vitro.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18302930 2008 CLIC4 interacts with histamine H3 receptor and enhances the receptor cell surface expression.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18028448 2007 Functional reconstitution of mammalian 'chloride intracellular channels' CLIC1, CLIC4 and CLIC5 reveals differential regulation by cytoskeletal actin.
17636002 2007 CLIC4 mediates and is required for Ca2+-induced keratinocyte differentiation.
17200346 2007 Reciprocal modifications of CLIC4 in tumor epithelium and stroma mark malignant progression of multiple human cancers.
16842122 2006 Expression, purification, crystallization and preliminary crystallographic analysis of the human intracellular chloride channel protein CLIC4.
16581025 2006 Trimeric structure of the wild soluble chloride intracellular ion channel CLIC4 observed in crystals.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16316993 2006 Quantitative proteomic analysis of myc-induced apoptosis: a direct role for Myc induction of the mitochondrial chloride ion channel, mtCLIC/CLIC4.
16239224 2005 Proteomic analysis of vascular endothelial growth factor-induced endothelial cell differentiation reveals a role for chloride intracellular channel 4 (CLIC4) in tubular morphogenesis.
16176272 2005 Crystal structure of the soluble form of the redox-regulated chloride ion channel protein CLIC4.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14569596 2003 CLIC4 is enriched at cell-cell junctions and colocalizes with AKAP350 at the centrosome and midbody of cultured mammalian cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12163479 2002 AKAP350 at the Golgi apparatus. II. Association of AKAP350 with a novel chloride intracellular channel (CLIC) family member.
12163372 2002 Differential expression of a chloride intracellular channel gene, CLIC4, in transforming growth factor-beta1-mediated conversion of fibroblasts to myofibroblasts.
11563969 2001 Chloride intracellular channel protein CLIC4 (p64H1) binds directly to brain dynamin I in a complex containing actin, tubulin and 14-3-3 isoforms.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10793131 2000 Identification of a novel member of the chloride intracellular channel gene family (CLIC5) that associates with the actin cytoskeleton of placental microvilli.
10191309 1999 A 29 kDa intracellular chloride channel p64H1 is associated with large dense-core vesicles in rat hippocampal neurons.
10070163 1999 A novel p64-related Cl- channel: subcellular distribution and nephron segment-specific expression.
10026142 1999 Purification and identification of a novel subunit of protein serine/threonine phosphatase 4.
9880541 1999 Molecular cloning and characterization of a mitogen-activated protein kinase-associated intracellular chloride channel.
9295337 1997 Rat brain p64H1, expression of a new member of the p64 chloride channel protein family in endoplasmic reticulum.
9139710 1997 Molecular cloning and expression of a chloride ion channel of cell nuclei.
8175911 1994 Identification of serum-inducible genes: different patterns of gene regulation during G0-->S and G1-->S progression.