Property Summary

NCBI Gene PubMed Count 16
PubMed Score 11.15
PubTator Score 9.49

Knowledge Summary

Patent (1,108)

Expression

  Differential Expression (12)

Disease log2 FC p
cystic fibrosis -2.097 5.0e-07
esophageal adenocarcinoma -3.600 2.0e-02
lung adenocarcinoma -1.700 4.7e-07
malignant mesothelioma 1.400 2.4e-05
nasopharyngeal carcinoma -1.900 7.5e-06
non-small cell lung cancer -2.958 9.3e-23
ovarian cancer -2.200 1.7e-08
pancreatic cancer -1.400 1.8e-02
pancreatic carcinoma -1.400 1.8e-02
psoriasis 1.300 5.6e-04
tuberculosis and treatment for 3 months -1.100 3.5e-03
type I diabetes mellitus -1.180 1.4e-02

Gene RIF (5)

AA Sequence

MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPILLYDSD      1 - 70
AKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDS     71 - 140
YLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAM    141 - 210
QEKEFKYTCPHSAEILAAYRPAVHPR                                                211 - 236
//

Text Mined References (18)

PMID Year Title