Property Summary

NCBI Gene PubMed Count 24
PubMed Score 26.26
PubTator Score 18.32

Knowledge Summary

Patent (625)

Expression

  Differential Expression (15)

Disease log2 FC p
oligodendroglioma -1.100 1.3e-02
osteosarcoma -1.470 2.4e-02
non-small cell lung cancer -1.804 1.6e-18
intraductal papillary-mucinous adenoma (... -2.100 1.5e-04
intraductal papillary-mucinous carcinoma... -2.200 1.9e-04
intraductal papillary-mucinous neoplasm ... -2.200 2.1e-03
lung cancer -2.800 1.0e-05
interstitial cystitis 1.400 6.0e-05
cystic fibrosis -1.200 9.0e-05
primary Sjogren syndrome 1.800 1.0e-04
lung carcinoma -2.500 2.1e-28
spina bifida -1.602 3.2e-02
acute myeloid leukemia -4.000 2.8e-05
ulcerative colitis 2.300 2.1e-06
ovarian cancer -1.200 1.8e-05

Gene RIF (5)

PMID Text
22814392 a vital role for the CLIC2 protein in maintaining normal cognitive function via its interaction with RyRs in the brain.
18186468 crystal structure of soluble human CICL2 and implications for function
18007051 Human CLIC2 was crystallized in 2 different forms, in presence of GSSH. Form A displayed P2(1)2(1)2(1) symmetry, with unit-cell parameters a=44.0, b=74.7, c=79.8 A. Form B displayed P2(1) symmetry, with unit-cell parameters a=36.0, b=66.9, c=44.1 A.
17945253 CLIC2 forms pH-dependent chloride channels in vitro with higher channel activity at low pH levels and that the channels are subject to redox regulation
15147738 CLIC2 inhibited cardiac ryanodine receptor Ca2+ release channels in lipid bilayers when added to the cytoplasmic side of the channels and inhibited Ca2+ release from cardiac sarcoplasmic reticulum vesicles

AA Sequence

MSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNP      1 - 70
PFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLL     71 - 140
KEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFS    141 - 210
GVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQKS                                     211 - 247
//

Text Mined References (26)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23871722 2013 XLID-causing mutations and associated genes challenged in light of data from large-scale human exome sequencing.
22814392 2012 An X-linked channelopathy with cardiomegaly due to a CLIC2 mutation enhancing ryanodine receptor channel activity.
21630357 2011 A missense mutation in CLIC2 associated with intellectual disability is predicted by in silico modeling to affect protein stability and dynamics.
21357393 2011 Refinement of the X-linked nonsyndromic high-grade myopia locus MYP1 on Xq28 and exclusion of 13 known positional candidate genes by direct sequencing.
21269460 2011 Initial characterization of the human central proteome.
18186468 2008 The crystal structure of human chloride intracellular channel protein 2: a disulfide bond with functional implications.
18007051 2007 Expression, purification, crystallization and preliminary X-ray diffraction analysis of chloride intracellular channel 2 (CLIC2).
17945253 2007 Structure of the Janus protein human CLIC2.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16130169 2005 Proteomics of human umbilical vein endothelial cells applied to etoposide-induced apoptosis.
15916532 2005 A recently identified member of the glutathione transferase structural family modifies cardiac RyR2 substate activity, coupled gating and activation by Ca2+ and ATP.
15772651 2005 The DNA sequence of the human X chromosome.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15147738 2004 CLIC-2 modulates cardiac ryanodine receptor Ca2+ release channels.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12681486 2003 Interaction of Sedlin with chloride intracellular channel proteins.
12601004 2003 Evidence for a functional interaction between the ClC-2 chloride channel and the retrograde motor dynein complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11076863 2000 DNA cloning using in vitro site-specific recombination.
9339381 1997 Genomic structure of a novel chloride channel gene, CLIC2, in Xq28.
8908511 1996 Transcriptional analysis of the candidate region for incontinentia pigmenti (IP2) in Xq28.
1311421 1992 A chloride channel widely expressed in epithelial and non-epithelial cells.