Property Summary

NCBI Gene PubMed Count 85
PubMed Score 789.50
PubTator Score 124.15

Knowledge Summary

Patent (3,572)

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus -1.100 3.8e-02

PDB (15)

Gene RIF (56)

AA Sequence

MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYG      1 - 70
TEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVL     71 - 140
DNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYL    141 - 210
SNAYAREEFASTCPDDEEIELAYEQVAKALK                                           211 - 241
//

Text Mined References (94)

PMID Year Title