Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.03
PubTator Score 0.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
chronic rhinosinusitis -1.400 3.5e-02
ependymoma 2.400 1.2e-02
group 3 medulloblastoma 1.300 4.3e-03
interstitial cystitis -1.100 7.6e-03
intraductal papillary-mucinous adenoma (... 1.300 8.9e-03
lung carcinoma 1.100 4.0e-07
ovarian cancer -1.400 3.8e-06
primitive neuroectodermal tumor 1.500 4.4e-03

Synonym

Accession Q8NHS4 B2RDV1 Q53R93 Q8N403
Symbols C2orf63

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MSVHQIRKHAVLPPIICRSDKEFLESVQRYIITETERLGCSEEGPADEYYIIYRNVFDKVIEHITAYKSI      1 - 70
LTSIKKEYDAFIETIKKDRRTTFCLHGKLKGLAAEPTALVYYRKRTIQLEAKMRIIESNSSKIQSQIDHI     71 - 140
KQCRAEYDTKEVKYCTFSKDPSKPIPGMTLQESMNLDALTKYMKHLEDKYAEIKQAMLIKYVPAQRKADL    141 - 210
DEEMIVLLKRRDVAENLNKKLQFCHQRLQIISQALSSWVKSDMSSPFQDFVEQIQKTKYLQGDQGIVEEL    211 - 280
MEDDPRRAKEAEIMLHYIERFNELISLGEYEKAACYAANSPRRILRNIGTMNTFKAVGKIRGKPLPLLLF    281 - 350
FEALFITSHAFPCPVDAALTLEGIKCGLSEKRLDLVTNWVTQERLTFSEEAGDVICDYGEQDTYNKAKCL    351 - 420
ALAQIVYSECGLHKKAILCLCKQGQTHRVMEYIQQLKDFTTDDLLQLLMSCPQVELIQCLTKELNEKQPS    421 - 490
LSFGLAILHLFSADMKKVGIKLLQEINKGGIDAVESLMINDSFCSIEKWQEVANICSQNGFDKLSNDITS    491 - 560
ILRSQAAVTEISEEDDAVNLMEHVFW                                                561 - 586
//

Text Mined References (9)

PMID Year Title