Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.63
PubTator Score 4.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
adult high grade glioma 2148 1.9e-04
osteosarcoma 7933 3.5e-04
interstitial cystitis 2299 8.2e-03
Disease Target Count Z-score Confidence
Multiple Sclerosis 498 0.0 2.0

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.244 3.5e-04
interstitial cystitis 2.100 8.2e-03
adult high grade glioma 1.500 1.9e-04

Gene RIF (4)

PMID Text
20237496 Observational study of gene-disease association. (HuGE Navigator)
19648166 C-type lectin-like molecule-1 is expressed in 86.5% of cases of acute myeloid leukemia, in 54.5% of acute myeloid leukemia CD34positiveCD38negative stem cells, but not in acute lymphoblastic leukemia blast cells.
19027044 incubation of immature DCs (iDCs) with an anti-DCAL-1 monoclonal antibody (mAb) induced downstream signaling, including phosphorylation of c-Jun N-terminal kinase (JNK) and p44/42 MAP kinase.
12421943 DCAL-1, highly expressed on dendritic cells and B lymphocytes, acts as a T cell costimulatory molecule which skews CD4+ T cells toward a Th2 response by enhancing their secretion of IL-4.

AA Sequence

MVSNFFHVIQVFEKSATLISKTEHIGFVIYSWRKSTTHLGSRRKFAISIYLSEVSLQKYDCPFSGTSFVV      1 - 70
FSLFLICAMAGDVVYADIKTVRTSPLELAFPLQRSVSFNFSTVHKSCPAKDWKVHKGKCYWIAETKKSWN     71 - 140
KSQNDCAINNSYLMVIQDITAMVRFNI                                               141 - 167
//

Text Mined References (9)

PMID Year Title
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19648166 2010 Targeting C-type lectin-like molecule-1 for antibody-mediated immunotherapy in acute myeloid leukemia.
19027044 2009 Ligation of dendritic cell-associated lectin-1 induces partial maturation of human monocyte derived dendritic cells.
17554300 2007 Genome-wide association study of 14,000 cases of seven common diseases and 3,000 shared controls.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421943 2002 Dendritic cell-associated lectin-1: a novel dendritic cell-associated, C-type lectin-like molecule enhances T cell secretion of IL-4.