Property Summary

NCBI Gene PubMed Count 18
PubMed Score 27.94
PubTator Score 16.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Gene RIF (6)

PMID Text
26129889 This study showed a genetic association between Dectin-2 and pulmonary cryptococcosis.
25659141 human plasmacytoid dendritic cells directly recognize A. fumigatus hyphae via Dectin-2
24129160 our data show a requirement for Dectin-2 in alveolar macrophage induction of cysteinyl leukotrienes and in the initiation of airway inflammation.
23606632 The Dectin-2 possess a single extracellular conserved C-type lectin-like domain and are capable of mediating intracellular signalling either directly, through integral signalling domains, or indirectly, by associating with signalling adaptor molecules.
21283787 Thus, dectin-1 and dectin-2 control adaptive T(H)-17 immunity to fungi via Malt1-dependent activation of c-Rel.
15810886 human DECTIN-2 has a role in innate immunity

AA Sequence

MMQEQQPQSTEKRGWLSLRLWSVAGISIALLSACFIVSCVVTYHFTYGETGKRLSELHSYHSSLTCFSEG      1 - 70
TKVPAWGCCPASWKSFGSSCYFISSEEKVWSKSEQNCVEMGAHLVVFNTEAEQNFIVQQLNESFSYFLGL     71 - 140
SDPQGNNNWQWIDKTPYEKNVRFWHLGEPNHSAEQCASIVFWKPTGWGWNDVICETRRNSICEMNKIYL     141 - 209
//

Text Mined References (20)

PMID Year Title
26129889 2015 Dectin-2 polymorphism associated with pulmonary cryptococcosis in HIV-uninfected Chinese patients.
25659141 2015 Recognition of Aspergillus fumigatus hyphae by human plasmacytoid dendritic cells is mediated by dectin-2 and results in formation of extracellular traps.
24362892 2014 Activation of neutrophils by autocrine IL-17A-IL-17RC interactions during fungal infection is regulated by IL-6, IL-23, ROR?t and dectin-2.
24129160 2014 Dectin-2 sensing of house dust mite is critical for the initiation of airway inflammation.
23932568 2013 Systems biology of host-mycobiota interactions: dissecting Dectin-1 and Dectin-2 signalling in immune cells with DC-ATLAS.
23928558 Dectin-2 is predominately macrophage restricted and exhibits conspicuous expression during Aspergillus fumigatus invasion in human lung.
23911656 2013 C-type lectin receptors Dectin-3 and Dectin-2 form a heterodimeric pattern-recognition receptor for host defense against fungal infection.
23606632 2013 The Dectin-2 family of C-type lectin-like receptors: an update.
23573288 2013 Lectin-dependent enhancement of Ebola virus infection via soluble and transmembrane C-type lectin receptors.
21677049 2011 Dectin-1 and Dectin-2 in innate immunity against fungi.
21283787 2011 Selective C-Rel activation via Malt1 controls anti-fungal T(H)-17 immunity by dectin-1 and dectin-2.
19665392 The Dectin-2 family of C-type lectins in immunity and homeostasis.
16541075 2006 The finished DNA sequence of human chromosome 12.
16423983 2006 The carbohydrate-recognition domain of Dectin-2 is a C-type lectin with specificity for high mannose.
15810886 2005 Identification and expression profiling of a human C-type lectin, structurally homologous to mouse dectin-2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15481152 2004 Signaling and immune regulatory role of the dendritic cell immunoreceptor (DCIR) family lectins: DCIR, DCAR, dectin-2 and BDCA-2.
15368084 2004 Identification of lectin-like receptors expressed by antigen presenting cells and neutrophils and their mapping to a novel gene complex.
15175046 2004 Molecular cloning of human dectin-2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.