Property Summary

NCBI Gene PubMed Count 18
PubMed Score 41.94
PubTator Score 26.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma 2.200 3.1e-05
Astrocytoma, Pilocytic 1.900 1.7e-06
atypical teratoid / rhabdoid tumor 1.300 1.6e-03
cutaneous lupus erythematosus -1.800 1.5e-03
ductal carcinoma in situ 1.300 4.6e-03
ependymoma 1.900 6.2e-06
glioblastoma 2.000 3.8e-04
interstitial cystitis 1.200 2.1e-02
invasive ductal carcinoma 1.400 4.9e-03
lung cancer -1.400 2.6e-02
lung carcinoma -1.400 2.0e-07
non primary Sjogren syndrome sicca -1.200 6.7e-03
osteosarcoma -3.987 4.5e-04
tuberculosis -3.000 1.6e-03

Gene RIF (10)

AA Sequence

MNWHMIISGLIVVVLKVVGMTLFLLYFPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTV      1 - 70
CPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRW     71 - 140
RWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK                          141 - 188
//

Text Mined References (18)

PMID Year Title