Property Summary

NCBI Gene PubMed Count 92
PubMed Score 100.97
PubTator Score 136.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
mucosa-associated lymphoid tissue lympho... 1.019 3.0e-02
osteosarcoma -1.118 2.8e-03
ovarian cancer -3.900 8.4e-13
pancreatic ductal adenocarcinoma liver m... -2.351 5.5e-04

Gene RIF (100)

AA Sequence

MSDSKEPRVQQLGLLEEDPTTSGIRLFPRDFQFQQIHGHKSSTGCLGHGALVLQLLSFMLLAGVLVAILV      1 - 70
QVSKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELT     71 - 140
RLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTE    141 - 210
LKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCY    211 - 280
FMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPS    281 - 350
FQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE                         351 - 399
//

Text Mined References (99)

PMID Year Title