Property Summary

Ligand Count 1
NCBI Gene PubMed Count 30
PubMed Score 58.59
PubTator Score 20.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
interstitial cystitis 1.500 8.5e-03
lung adenocarcinoma -1.100 2.7e-07
lung carcinoma -1.900 5.5e-11
mucosa-associated lymphoid tissue lympho... 1.593 7.9e-03
non-small cell lung cancer -1.181 2.5e-11
osteosarcoma -1.885 6.5e-05
pancreatic cancer 1.100 5.3e-03
pancreatic carcinoma 1.100 5.3e-03
psoriasis 2.100 2.0e-45
tuberculosis and treatment for 6 months -1.300 1.4e-02
ulcerative colitis 1.300 1.3e-03

Protein-protein Interaction (3)

Gene RIF (22)

AA Sequence

MNSSKSSETQCTERGCFSSQMFLWTVAGIPILFLSACFITRCVVTFRIFQTCDEKKFQLPENFTELSCYN      1 - 70
YGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIG     71 - 140
LSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRICEMVGI    141 - 210
NPLNKGKSL                                                                 211 - 219
//

Text Mined References (33)

PMID Year Title