Property Summary

NCBI Gene PubMed Count 9
PubMed Score 25.12
PubTator Score 100.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Lung diseases 50 0.0 0.0
Disease Target Count P-value
psoriasis 6694 1.2e-38
osteosarcoma 7950 1.2e-06
tuberculosis 2010 1.7e-03
mucosa-associated lymphoid tissue lymphoma 484 2.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (4)

Disease log2 FC p
mucosa-associated lymphoid tissue lympho... 2.398 2.5e-02
osteosarcoma -3.952 1.2e-06
psoriasis 3.300 1.2e-38
tuberculosis 1.100 1.7e-03

Gene RIF (3)

AA Sequence

MGLEKPQSKLEGGMHPQLIPSVIAVVFILLLSVCFIASCLVTHHNFSRCKRGTGVHKLEHHAKLKCIKEK      1 - 70
SELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLS     71 - 140
YFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIP    141 - 210
GTTLN                                                                     211 - 215
//

Text Mined References (10)

PMID Year Title