Property Summary

NCBI Gene PubMed Count 22
PubMed Score 22.47
PubTator Score 19.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
cutaneous lupus erythematosus 1.700 4.1e-03
psoriasis -3.000 1.3e-05
osteosarcoma -2.615 7.2e-05
tuberculosis and treatment for 6 months -1.100 2.0e-02
lung cancer -1.500 6.6e-04
interstitial cystitis 1.400 2.0e-02
sonic hedgehog group medulloblastoma 1.100 2.9e-07
lung carcinoma -1.900 5.4e-19
head and neck cancer -1.100 8.7e-03

 GWAS Trait (1)

Gene RIF (17)

PMID Text
26829983 these data suggest that LLT1-CD161 interactions play a novel and important role in B cell maturation within the Germinal center in humans.
26147876 In RA joints, LLT1 is expressed by cells of the monocyte/macrophage lineage.
25760607 The hexamer of glycosylated LLT1 consists of three classical dimers. The hexameric packing may indicate a possible mode of interaction of C-type lectin-like proteins in the glycosylated form.
23333304 HIV-1 Vif downregulates the expression of C-type lectin domain family 2, member D (CLEC2D) in Vif-expression T cells
22664939 One polymorphism in LLT1 was found to be associated with our Crohn's Disease population (P<0.034).Our Ulcerative Colitis cohort was not associated with the variation in LLT1 (P=0.33)
21930700 LLT1 and CD161 have roles in modulating immune responses to pathogens; and interferon-gamma contributes to modulate immune responses
21572041 Molecular basis for LLT1 protein recognition by human CD161 protein (NKRP1A/KLRB1).
20843815 Data show that only CLEC2D isoform 1 (LLT1) is expressed on the cell surface.
20415786 LLT1 used Src-PTK, p38 and ERK signalling pathways, but not PKC, PI3K or calcineurin pathways, to increase production of IFN-gamma by human natural killer cells.
18593762 Observational study of gene-disease association. (HuGE Navigator)
18465072 Women with a lysine (GG genotype) at position 19 of the OCIL protein displayed lower bone mineral density at femoral neck and at lumbar spine sites than women having an asparagine residue.
18465072 Observational study of gene-disease association. (HuGE Navigator)
18453569 Expression of LLT1 on activated dendritic cells and B cells suggests that it might regulate the cross-talk between NK cells and APCs
16339513 LLT1 on target cells can inhibit NK cytotoxicity via interactions with CD161. LLT1 activates NFAT-GFP reporter cells expressing a CD3zeta-CD161 chimeric receptor; reciprocally, reporter cells with a CD3zeta-LLT1 chimeric receptor are stimulated by CD161
16339512 Engagement of CD161 on NK cells with LLT1 expressed on target cells inhibited NK cell-mediated cytotoxicity and IFN-gamma secretion. LLT1/CD161 interaction in the presence of a TCR signal enhanced IFN-gamma production by T cells
15123656 Data show that osteoclast inhibitory lectin (OCIL) binds a range of physiologically important glycosaminoglycans, and this property may modulate OCIL actions upon other cells [OCIL].
15104121 LLT1 induces Interferon Type II production by natural killer cells.

AA Sequence

MHDSNNVEKDITPSELPANPGCLHSKEHSIKATLIWRLFFLIMFLTIIVCGMVAALSAIRANCHQEPSVC      1 - 70
LQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQG     71 - 140
QPWKWINGTEWTRQFPILGAGECAYLNDKGASSARHYTERKWICSKSDIHV                       141 - 191
//

Text Mined References (24)

PMID Year Title
26829983 2016 LLT1 and CD161 Expression in Human Germinal Centers Promotes B Cell Activation and CXCR4 Downregulation.
26147876 2015 Expression of Lectin-Like Transcript 1, the Ligand for CD161, in Rheumatoid Arthritis.
25760607 2015 Four crystal structures of human LLT1, a ligand of human NKR-P1, in varied glycosylation and oligomerization states.
22664939 2012 Single nucleotide polymorphisms in C-type lectin genes, clustered in the IBD2 and IBD6 susceptibility loci, may play a role in the pathogenesis of inflammatory bowel diseases.
21930700 2011 Induction of lectin-like transcript 1 (LLT1) protein cell surface expression by pathogens and interferon-? contributes to modulate immune responses.
21572041 2011 Molecular basis for LLT1 protein recognition by human CD161 protein (NKRP1A/KLRB1).
20843815 2010 Characterization of alternatively spliced transcript variants of CLEC2D gene.
20415786 2010 LLT1-mediated activation of IFN-gamma production in human natural killer cells involves ERK signalling pathway.
18593762 2008 Polymorphisms in CLEC16A and CIITA at 16p13 are associated with primary adrenal insufficiency.
18465072 2008 The Asn19Lys substitution in the osteoclast inhibitory lectin (OCIL) gene is associated with a reduction of bone mineral density in postmenopausal women.
18453569 2008 Functional consequences of interactions between human NKR-P1A and its ligand LLT1 expressed on activated dendritic cells and B cells.
17554300 2007 Genome-wide association study of 14,000 cases of seven common diseases and 3,000 shared controls.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16339513 2005 Cutting edge: lectin-like transcript-1 is a ligand for the inhibitory human NKR-P1A receptor.
16339512 2005 Cutting edge: lectin-like transcript 1 is a ligand for the CD161 receptor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15123656 2004 Characterization of sugar binding by osteoclast inhibitory lectin.
15104121 2004 The LLT1 receptor induces IFN-gamma production by human natural killer cells.
14990792 2004 Missing self-recognition of Ocil/Clr-b by inhibitory NKR-P1 natural killer cell receptors.
14753741 2004 Isolation of a human homolog of osteoclast inhibitory lectin that inhibits the formation and function of osteoclasts.
12858173 2003 Genetically linked C-type lectin-related ligands for the NKRP1 family of natural killer cell receptors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10541800 1999 Cloning of a new lectin-like receptor expressed on human NK cells.