Property Summary

NCBI Gene PubMed Count 16
PubMed Score 43.17
PubTator Score 27.87

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
26418160 Data suggest that vascular smooth muscle cells (VSMCs) stimulate platelets through platelet receptor CLEC-2, possibly leading to thrombus formation after plaque erosion.
25462818 Lipid rafts do not directly contribute to CLEC-2 receptor activation in platelets.
23929856 our data report a previously unrecognized regulatory circuit enabling autonomous control of human NK cell responses via the NKp80-AICL axis.
20663776 expressed in primary liver cancers
20237496 Observational study of gene-disease association. (HuGE Navigator)
18922855 NKp80 is expressed on a highly responsive subset of effector memory CD8 T cells with an inflammatory NK-like phenotype and promotes T-cell responses toward AICL-expressing cells.

AA Sequence

MMTKHKKCFIIVGVLITTNIITLIVKLTRDSQSLCPYDWIGFQNKCYYFSKEEGDWNSSKYNCSTQHADL      1 - 70
TIIDNIEEMNFLRRYKCSSDHWIGLKMAKNRTGQWVDGATFTKSFGMRGSEGCAYLSDDGAATARCYTER     71 - 140
KWICRKRIH                                                                 141 - 149
//

Text Mined References (18)

PMID Year Title
26418160 2015 Vascular Smooth Muscle Cells Stimulate Platelets and Facilitate Thrombus Formation through Platelet CLEC-2: Implications in Atherothrombosis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25462818 2015 C-type lectin like receptor 2 (CLEC-2) signals independently of lipid raft microdomains in platelets.
23929856 2013 Genetically coupled receptor-ligand pair NKp80-AICL enables autonomous control of human NK cell responses.
20663776 2010 Tumor cells of non-hematopoietic and hematopoietic origins express activation-induced C-type lectin, the ligand for killer cell lectin-like receptor F1.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
18922855 2009 NKp80 defines and stimulates a reactive subset of CD8 T cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12945048 2003 Evolutionary analysis reveals collective properties and specificity in the C-type lectin and lectin-like domain superfamily.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10783260 2000 A sequence-ready physical map of the region containing the human natural killer gene complex on chromosome 12p12.3-p13.2.
10508765 1999 C-type lectin-like domains.
10072769 1999 Selection of cDNAs encoding putative type II membrane proteins on the cell surface from a human full-length cDNA bank.
9038101 1997 AICL: a new activation-induced antigen encoded by the human NK gene complex.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.