Property Summary

NCBI Gene PubMed Count 17
PubMed Score 54.31
PubTator Score 27.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
acute quadriplegic myopathy 1.257 5.2e-07
adult high grade glioma 1.100 4.5e-02
Astrocytoma, Pilocytic 1.400 3.3e-03
autosomal dominant Emery-Dreifuss muscul... 1.190 5.4e-04
Chronic Lymphocytic Leukemia -1.781 1.4e-02
cystic fibrosis -1.200 1.3e-03
cystic fibrosis and chronic rhinosinusit... 1.287 4.4e-03
dermatomyositis 1.100 1.8e-02
ependymoma 1.200 8.2e-04
glioblastoma 1.700 4.7e-04
intraductal papillary-mucinous adenoma (... -1.900 9.4e-04
intraductal papillary-mucinous carcinoma... -1.200 5.0e-02
intraductal papillary-mucinous neoplasm ... -1.100 4.5e-02
juvenile dermatomyositis 1.069 6.9e-10
lung adenocarcinoma -1.250 1.3e-03
lung cancer -2.100 2.5e-04
lung carcinoma -2.200 3.2e-24
malignant mesothelioma -6.100 1.9e-09
nephrosclerosis 1.093 4.8e-04
non-small cell lung cancer -1.455 8.7e-10
osteosarcoma -2.876 5.7e-04
ovarian cancer -1.800 2.9e-04
pancreatic cancer 1.100 2.0e-03
primary pancreatic ductal adenocarcinoma 1.149 2.8e-03
primary Sjogren syndrome 1.300 1.8e-03
psoriasis -1.200 9.6e-03
sarcoidosis 1.200 3.3e-02
ulcerative colitis 2.500 4.3e-06
Waldenstrons macroglobulinemia -1.526 2.2e-02

Gene RIF (6)

AA Sequence

MMTKHKKCFIIVGVLITTNIITLIVKLTRDSQSLCPYDWIGFQNKCYYFSKEEGDWNSSKYNCSTQHADL      1 - 70
TIIDNIEEMNFLRRYKCSSDHWIGLKMAKNRTGQWVDGATFTKSFGMRGSEGCAYLSDDGAATARCYTER     71 - 140
KWICRKRIH                                                                 141 - 149
//

Text Mined References (19)

PMID Year Title