Property Summary

NCBI Gene PubMed Count 34
PubMed Score 79.15
PubTator Score 59.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
gastric cancer 1.500 6.7e-04
hepatocellular carcinoma 1.400 6.2e-03
pancreatic cancer 1.700 2.3e-04
osteosarcoma -3.841 3.6e-06
pancreatic ductal adenocarcinoma liver m... -2.952 6.6e-04
pancreatic carcinoma 1.700 2.3e-04
axial spondyloarthropathy 1.100 4.4e-02

Gene RIF (27)

PMID Text
25858425 CLEC-2 regulates Akt and MAPK downstream of PI3K and PKC, leading to phosphorylation and inhibition of GSK3alpha/beta, and enhanced platelet aggregation and secretion.
25849538 Data (including data from studies using recombinant proteins) suggest that a diverse range of ligands activate platelets through activation/phosphorylation of CD36/GPVI (glycoprotein VI) and/or CLEC-2 (C-type lectin-like receptor-2).
25767114 PI3K and Tec family kinases play a crucial role in the regulation of platelet activation and Syk phosphorylation downstream of the CLEC-2 receptor
23341451 fucoidan is a novel CLEC-2 receptor agonist that activates platelets through a SFK-dependent signaling pathway
23264619 Dimerization of two phosphorylated CLEC-2 molecules leads to recruitment of the tyrosine kinase Syk via its tandem SH2 domains and initiation of a downstream signaling cascade
23053573 A differential proteomic analysis of basal and rhodocytin-activated platelets with the aim of providing novel clues on CLEC-2 signaling regulation.
22740230 The glycosylation sites (N120 and N134) are necessary for the surface expression of CLEC-2.
22736279 Shedding of CLEC-2 from the cell surface may reflect increased expression of this membrane protein and serve as a marker of disease activity.
22682130 Here, the bidirectional relationship between CLEC-2 and podoplanin is described and considered in the context of tumour growth and metastasis.
22556408 platelets regulate blood/lymphatic vessel separation by inhibiting the proliferation, migration, and tube formation of LECs, mainly because of the release of BMP-9 upon activation by CLEC-2/podoplanin in
21714702 CLEC-2 is the first member of the C-type lectin family of receptors identified to stimulate platelet aggregation through a tyrosine kinase-dependent pathway. (Review)
20549515 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20482880 Virion incorporation of podoplanin mediates CLEC-2 interactions of HIV-1 derived from 293T cells, while incorporation of a different cellular factor seems to be responsible for CLEC-2-dependent capture of PBMC-derived viruses.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20154219 CLEC-2 activates Syk through dimerization.
20154214 Phosphorylation of CLEC-2 is dependent on lipid rafts, actin polymerization, secondary mediators, and Rac1.
19824697 CLEC-2 exists as a non-disulfide-linked homodimer which could allow each Syk molecule to interact with two YXXL motifs, one from each CLEC-2 monomer.
19785988 RACK1 is a novel modulator of CLEC-2 expression.
19483399 It is the novel platelet activation receptor. (review)
18955485 G6b-B inhibits constitutive and agonist-induced signaling by glycoprotein VI and CLEC-2.
18707544 NZ-1 neutralizes the interaction between podoplanin and CLEC-2, which may lead to the development of therapeutic antibodies against podoplanin-dependent cancer metastasis.
18583525 Crystal structure of rhodocytin, a ligand for the platelet-activating receptor CLEC2, is reported.
18215137 a direct interaction between CLEC-2 and podoplanin was confirmed; podoplanin is a ligand for CLEC-2 on renal cells.
17616532 CLEC-2 is a physiological target protein of podoplanin and imply that it is involved in podoplanin-induced platelet aggregation, tumor metastasis
17132623 Framework for understanding the effects of rhodocytin venom binding on CLEC-2 and for understanding the nature of endogenous ligands which will provide a basis for rational design of drugs to block ligand binding.
16940507 platelets capture and transfer infectious HIV-1 via DC-SIGN and CLEC-2, thereby possibly facilitating HIV-1 dissemination in infected patients
16511244 X-ray diffraction analysis of human CLEC-2

AA Sequence

MQDEDGYITLNIKTRKPALISVGSASSSWWRVMALILLILCVGMVVGLVALGIWSVMQRNYLQGENENRT      1 - 70
GTLQQLAKRFCQYVVKQSELKGTFKGHKCSPCDTNWRYYGDSCYGFFRHNLTWEESKQYCTDMNATLLKI     71 - 140
DNRNIVEYIKARTHLIRWVGLSRQKSNEVWKWEDGSVISENMFEFLEDGKGNMNCAYFHNGKMHPTFCEN    141 - 210
KHYLMCERKAGMTKVDQLP                                                       211 - 229
//

Text Mined References (34)

PMID Year Title
25858425 2015 Akt and mitogen-activated protein kinase enhance C-type lectin-like receptor 2-mediated platelet activation by inhibition of glycogen synthase kinase 3?/?.
25849538 2015 Activation of glycoprotein VI (GPVI) and C-type lectin-like receptor-2 (CLEC-2) underlies platelet activation by diesel exhaust particles and other charged/hydrophobic ligands.
25767114 2015 Distinct pathways regulate Syk protein activation downstream of immune tyrosine activation motif (ITAM) and hemITAM receptors in platelets.
23341451 2013 Fucoidan is a novel platelet agonist for the C-type lectin-like receptor 2 (CLEC-2).
23264619 2013 Critical Role for an acidic amino acid region in platelet signaling by the HemITAM (hemi-immunoreceptor tyrosine-based activation motif) containing receptor CLEC-2 (C-type lectin receptor-2).
23053573 2012 A detailed proteomic analysis of rhodocytin-activated platelets reveals novel clues on the CLEC-2 signalosome: implications for CLEC-2 signaling regulation.
22740230 2012 Structural and functional conservation of CLEC-2 with the species-specific regulation of transcript expression in evolution.
22736279 2012 The production of soluble C-type lectin-like receptor 2 is a regulated process.
22682130 2012 Platelet CLEC-2 and podoplanin in cancer metastasis.
22556408 2012 Platelet activation receptor CLEC-2 regulates blood/lymphatic vessel separation by inhibiting proliferation, migration, and tube formation of lymphatic endothelial cells.
21714702 2011 The novel platelet activation receptor CLEC-2.
20549515 2010 Genome-wide searching of rare genetic variants in WTCCC data.
20482880 2010 Incorporation of podoplanin into HIV released from HEK-293T cells, but not PBMC, is required for efficient binding to the attachment factor CLEC-2.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20154219 2010 CLEC-2 activates Syk through dimerization.
20154214 2010 Phosphorylation of CLEC-2 is dependent on lipid rafts, actin polymerization, secondary mediators, and Rac.
19824697 2009 The platelet receptor CLEC-2 is active as a dimer.
19785988 2009 RACK1 associates with CLEC-2 and promotes its ubiquitin-proteasome degradation.
19483399 2009 CLEC-2, the novel platelet activation receptor and its internal ligand, podoplanin.
18955485 2008 G6b-B inhibits constitutive and agonist-induced signaling by glycoprotein VI and CLEC-2.
18707544 2008 Characterization of anti-podoplanin monoclonal antibodies: critical epitopes for neutralizing the interaction between podoplanin and CLEC-2.
18583525 2008 Crystal structure of rhodocytin, a ligand for the platelet-activating receptor CLEC-2.
18215137 2008 Renal cells activate the platelet receptor CLEC-2 through podoplanin.
17616532 2007 Involvement of the snake toxin receptor CLEC-2, in podoplanin-mediated platelet activation, by cancer cells.
17132623 2007 The crystal structure and mutational binding analysis of the extracellular domain of the platelet-activating receptor CLEC-2.
16940507 2006 DC-SIGN and CLEC-2 mediate human immunodeficiency virus type 1 capture by platelets.
16541075 2006 The finished DNA sequence of human chromosome 12.
16511244 2005 Crystallization and X-ray diffraction analysis of human CLEC-2.
16174766 2006 A novel Syk-dependent mechanism of platelet activation by the C-type lectin receptor CLEC-2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11745369 2001 A novel cluster of lectin-like receptor genes expressed in monocytic, dendritic and endothelial cells maps close to the NK receptor genes in the human NK gene complex.
10671229 2000 Molecular characterization of two novel C-type lectin-like receptors, one of which is selectively expressed in human dendritic cells.