Property Summary

NCBI Gene PubMed Count 76
PubMed Score 38.47
PubTator Score 46.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.100 1.4e-03
osteosarcoma -1.899 2.2e-06

Pathway (1)

Gene RIF (63)

PMID Text
26203907 A possible regulatory role for the multiple sclerosis-associated rs12927355 in CLEC16A.
26121298 CLEC16A was found to be a susceptibility factor for SLE, with possible contribution to the development of the disease.
25903733 This study demonstrated that the Polymorphism, Single Nucleotide of CLEC16A is associated with multiple sclerosis in Russia.
25891430 Clec16a knockdown mice showed reduced number of B cells and elevated IgM levels compared with controls.
25823473 identify CLEC16A as a pivotal gene in multiple sclerosis that serves as a direct regulator of the human leukocyte antigen class II pathway in antigen-presenting cells.
25576669 The study suggested that a CLEC16A polymorphism may be protective against Vogt-Koyanagi-Harada syndrome syndrome in a Chinese Han population.
25447402 data suggests that two polymorphisms of the CLEC16A gene play an important role in the developing of ACS in men.
25008175 Forty-eight SNPs, all located in CLEC16A, provided a statistically significant association with type 1 diabetes mellitus, with rs34306440 being most significantly associated. The mechanisim is likely through reduced expression of DEXI transcripts.
24949970 Study demonstrates that a diabetogenic SNP in the CLEC16A locus correlates with islet CLEC16A expression, beta cell function, and glycemic control in human subjects. Clec16a controls beta cell function and prevents diabetes by controlling mitophagy.
24646814 Our results suggest that polymorphisms rs6498169 of CLEC16A gene confers susceptibility to AITDs. We therefore disclose for the first time the association of rs6498169 SNP with AITDs.
23151489 The data indicates a possible regulatory role for multiple sclerosis-associated non-coding CLEC16A SNPs and a common control mechanism for the expression of CLEC16A, SOCS1 and DEXI.
23133532 Polymorphisms in the inflammatory genes CIITA, CLEC16A and IFNG influence BMD, bone loss and fracture in elderly women
22534877 Genome-wide significant association was found for rs20541 and rs998592, thus establishing IL-13 and KIAA0350/CLEC16A as susceptibility loci for alopecia areata. IL-13 and KIAA0350/CLEC16A are also susceptibility loci for other autoimmune diseases.
22257840 Fine mapping identified 26 single-nucleotide polymorphisms (SNPs) across the CLEC16A-SOCS1 and 11 SNPs across the SPIB locus with significant association to primary biliary cirrhosis.
21653641 Data show independent genetic signals in the CIITA-CLEC16A-SOCS1 gene complex in multiple sclerosis susceptibility.
21179112 Expression analysis revealed that rs12708716 genotype was significantly associated with the relative expression levels of two different CLEC16A transcripts in thymus (P=0.004)
20962850 Observational study of gene-disease association. (HuGE Navigator)
20849399 A significant association with multiple sclerosis is found for four single nucleotide polymorphisms within the CLEC16A gene, all located in the same linkage disequilibrium (LD) block.
20849399 Observational study of gene-disease association. (HuGE Navigator)
20805369 Observational study of gene-disease association. (HuGE Navigator)
20694011 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20450971 Studies indicate that SNP in IL7RA, IL2RA, CD58 and CLEC16A genes has been consistently associated with MS.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20372818 Observational study of gene-disease association. (HuGE Navigator)
20368992 Observational study of gene-disease association. (HuGE Navigator)
20220768 Results show that CLEC16A does not have a prominent function in susceptibility to anti-cyclic citrullinated peptide (CCP)-positive rheumatoid arthritis.
20220768 Observational study of gene-disease association. (HuGE Navigator)
20203524 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
20095854 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20043139 The initial chi-square test revealed that the Cright curved arrow T polymorphism of CLEC16A and the Aright curved arrow G polymorphism of SPTBN5 were significantly ssociated with ischemic stroke among individuals with metabolic syndrome.
20036365 SEMA3F, CLEC16A, LAMA3, and PCSK2 variants have roles in myocardial infarction in Japanese individuals
19951419 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19879194 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19865102 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19838195 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19834503 Studies indicate that five SNPs showed genome-wide significant association with MS: HLA-DRA, IL7R, IL2RA, CD58 and CLEC16A.
19834503 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19734133 A CLEC16A variant confers risk for juvenile idiopathic arthritis and anti-cyclic citrullinated peptide antibody negative rheumatoid arthritis
19734133 Observational study of gene-disease association. (HuGE Navigator)
19525955 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19506219 Observational study of gene-disease association. (HuGE Navigator)
19375175 Observational study of gene-disease association. (HuGE Navigator)
19337309 a CLEC16A/KIAA0350 polymorphism may have a role in NOD2/CARD15(-) Crohn's disease patients
19337309 Observational study of gene-disease association. (HuGE Navigator)
19317741 Autoimmune disease association signals in KIAA0350 are not involved in celiac disease susceptibility
19317741 Observational study of gene-disease association. (HuGE Navigator)
19264985 Observational study of gene-disease association. (HuGE Navigator)
19221398 Observational study of gene-disease association. (HuGE Navigator)
19178520 The intron polymorphism rs725613 in the KIAA0350 gene is associated with susceptibility to type 1 diabetes in the Chinese population.
19178520 Observational study of gene-disease association. (HuGE Navigator)
19073967 Observational study of gene-disease association. (HuGE Navigator)
18987646 CLEC16A is a multiple sclerosis susceptibility gene.
18987646 Observational study of gene-disease association. (HuGE Navigator)
18946483 Variation within the CLEC16A gene shows consistent disease association with both multiple sclerosis and type 1 diabetes in Italy.
18946483 Observational study of gene-disease association. (HuGE Navigator)
18940880 Observational study of gene-disease association. (HuGE Navigator)
18650830 There is evidence of a genome-wide significant association between KIAA0350 and risk of multiple sclerosis in Australians.
18593762 Two alleles at 16p13 are independently associated with the risk of Addison's disease in the Norwegian population, suggesting this chromosomal region to harbor common autoimmunity gene(s), CLEC16A and CIITA being possible independent candidates.
18593762 Observational study of gene-disease association. (HuGE Navigator)
17632545 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17632545 results indicate that KIAA0350 might be involved in the pathogenesis of type 1 diabetes and demonstrate the utility of the genome-wide association approach in the identification of previously unsuspected genetic determinants of complex traits

AA Sequence

MFGRSRSWVGGGHGKTSRNIHSLDHLKYLYHVLTKNTTVTEQNRNLLVETIRSITEILIWGDQNDSSVFD      1 - 70
FFLEKNMFVFFLNILRQKSGRYVCVQLLQTLNILFENISHETSLYYLLSNNYVNSIIVHKFDFSDEEIMA     71 - 140
YYISFLKTLSLKLNNHTVHFFYNEHTNDFALYTEAIKFFNHPESMVRIAVRTITLNVYKVSLDNQAMLHY    141 - 210
IRDKTAVPYFSNLVWFIGSHVIELDDCVQTDEEHRNRGKLSDLVAEHLDHLHYLNDILIINCEFLNDVLT    211 - 280
DHLLNRLFLPLYVYSLENQDKGGERPKISLPVSLYLLSQVFLIIHHAPLVNSLAEVILNGDLSEMYAKTE    281 - 350
QDIQRSSAKPSIRCFIKPTETLERSLEMNKHKGKRRVQKRPNYKNVGEEEDEEKGPTEDAQEDAEKAKGT    351 - 420
EGGSKGIKTSGESEEIEMVIMERSKLSELAASTSVQEQNTTDEEKSAAATCSESTQWSRPFLDMVYHALD    421 - 490
SPDDDYHALFVLCLLYAMSHNKGMDPEKLERIQLPVPNAAEKTTYNHPLAERLIRIMNNAAQPDGKIRLA    491 - 560
TLELSCLLLKQQVLMSAGCIMKDVHLACLEGAREESVHLVRHFYKGEDIFLDMFEDEYRSMTMKPMNVEY    561 - 630
LMMDASILLPPTGTPLTGIDFVKRLPCGDVEKTRRAIRVFFMLRSLSLQLRGEPETQLPLTREEDLIKTD    631 - 700
DVLDLNNSDLIACTVITKDGGMVQRFLAVDIYQMSLVEPDVSRLGWGVVKFAGLLQDMQVTGVEDDSRAL    701 - 770
NITIHKPASSPHSKPFPILQATFIFSDHIRCIIAKQRLAKGRIQARRMKMQRIAALLDLPIQPTTEVLGF    771 - 840
GLGSSTSTQHLPFRFYDQGRRGSSDPTVQRSVFASVDKVPGFAVAQCINQHSSPSLSSQSPPSASGSPSG    841 - 910
SGSTSHCDSGGTSSSSTPSTAQSPADAPMSPELPKPHLPDQLVIVNETEADSKPSKNVARSAAVETASLS    911 - 980
PSLVPARQPTISLLCEDTADTLSVESLTLVPPVDPHSLRSLTGMPPLSTPAAACTEPVGEEAACAEPVGT    981 - 1050
AED                                                                      1051 - 1053
//

Text Mined References (76)

PMID Year Title
26203907 2015 Multiple Sclerosis Risk Allele in CLEC16A Acts as an Expression Quantitative Trait Locus for CLEC16A and SOCS1 in CD4+ T Cells.
26121298 2015 Systemic Lupus Erythematosus Patients Exhibit Reduced Expression of CLEC16A Isoforms in Peripheral Leukocytes.
25903733 2015 GWAS-identified multiple sclerosis risk loci involved in immune response: validation in Russians.
25891430 2015 Association of CLEC16A with human common variable immunodeficiency disorder and role in murine B cells.
25823473 2015 Multiple sclerosis-associated CLEC16A controls HLA class II expression via late endosome biogenesis.
25576669 2015 A variant of CLEC16A gene confers protection for Vogt-Koyanagi-Harada syndrome but not for Behcet's disease in a Chinese Han population.
25447402 2014 Association of the C-type lectin-like domain family-16A (CLEC16A) gene polymorphisms with acute coronary syndrome in Mexican patients.
25008175 2014 Fine mapping and functional studies of risk variants for type 1 diabetes at chromosome 16p13.13.
24949970 2014 The diabetes susceptibility gene Clec16a regulates mitophagy.
24646814 2014 Polymorphisms of CLEC16A region and autoimmune thyroid diseases.
24388013 2014 Genome-wide association analysis identifies 11 risk variants associated with the asthma with hay fever phenotype.
23817569 2013 A genome-wide association meta-analysis of self-reported allergy identifies shared and allergy-specific susceptibility loci.
23273568 2013 Meta-analysis followed by replication identifies loci in or near CDKN1B, TET3, CD80, DRAM1, and ARID5B as associated with systemic lupus erythematosus in Asians.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23151489 2013 Multiple sclerosis-associated single-nucleotide polymorphisms in CLEC16A correlate with reduced SOCS1 and DEXI expression in the thymus.
23133532 2012 Polymorphisms in the inflammatory genes CIITA, CLEC16A and IFNG influence BMD, bone loss and fracture in elderly women.
23042114 2012 Genome-wide association study identifies eight new susceptibility loci for atopic dermatitis in the Japanese population.
22534877 2012 Follow-up study of the first genome-wide association scan in alopecia areata: IL13 and KIAA0350 as susceptibility loci supported with genome-wide significance.
22257840 2012 Association of primary biliary cirrhosis with variants in the CLEC16A, SOCS1, SPIB and SIAE immunomodulatory genes.
22036096 2011 A genome-wide meta-analysis of genetic variants associated with allergic rhinitis and grass sensitization and their interaction with birth order.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21829393 2011 Genome-wide association analysis of autoantibody positivity in type 1 diabetes cases.
21653641 2011 Interrogating the complex role of chromosome 16p13.13 in multiple sclerosis susceptibility: independent genetic signals in the CIITA-CLEC16A-SOCS1 gene complex.
21399635 2011 Genome-wide association study identifies 12 new susceptibility loci for primary biliary cirrhosis.
21179112 2011 Exploring the CLEC16A gene reveals a MS-associated variant with correlation to the relative expression of CLEC16A isoforms in thymus.
20962850 2011 A targeted association study in systemic lupus erythematosus identifies multiple susceptibility alleles.
20849399 2011 More CLEC16A gene variants associated with multiple sclerosis.
20805369 2011 Polymorphisms at 16p13 are associated with systemic lupus erythematosus in the Chinese population.
20694011 2010 Association of IFIH1 and other autoimmunity risk alleles with selective IgA deficiency.
20450971 2010 The genetics of multiple sclerosis: an update 2010.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20372818 2010 Genetic risk for myocardial infarction in Japanese individuals with or without chronic kidney disease.
20368992 2010 Multiple sclerosis susceptibility-associated SNPs do not influence disease severity measures in a cohort of Australian MS patients.
20220768 2010 A candidate gene study of CLEC16A does not provide evidence of association with risk for anti-CCP-positive rheumatoid arthritis.
20203524 2010 Genetic susceptibility to type 2 diabetes is associated with reduced prostate cancer risk.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
20190752 2010 Multiple common variants for celiac disease influencing immune gene expression.
20095854 2010 Novel breast cancer risk alleles and interaction with ionizing radiation among U.S. radiologic technologists.
20043139 2010 Association of genetic variants with ischemic stroke in Japanese individuals with or without metabolic syndrome.
20036365 2010 Association of genetic variants in SEMA3F, CLEC16A, LAMA3, and PCSK2 with myocardial infarction in Japanese individuals.
19951419 2009 Confirmation of the genetic association of CTLA4 and PTPN22 with ANCA-associated vasculitis.
19879194 2009 Integration of genetic risk factors into a clinical algorithm for multiple sclerosis susceptibility: a weighted genetic risk score.
19865102 2010 Multiple sclerosis susceptibility alleles in African Americans.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19838195 2009 A large-scale replication study identifies TNIP1, PRDM1, JAZF1, UHRF1BP1 and IL10 as risk loci for systemic lupus erythematosus.
19834503 2009 Replication of CD58 and CLEC16A as genome-wide significant risk genes for multiple sclerosis.
19734133 2010 A CLEC16A variant confers risk for juvenile idiopathic arthritis and anti-cyclic citrullinated peptide antibody negative rheumatoid arthritis.
19525955 2009 Genome-wide association study identifies new multiple sclerosis susceptibility loci on chromosomes 12 and 20.
19525953 2009 Meta-analysis of genome scans and replication identify CD6, IRF8 and TNFRSF1A as new multiple sclerosis susceptibility loci.
19506219 2009 Risk alleles for multiple sclerosis in multiplex families.
19430480 2009 Genome-wide association study and meta-analysis find that over 40 loci affect risk of type 1 diabetes.
19375175 2009 Fine mapping of multiple sclerosis susceptibility genes provides evidence of allelic heterogeneity at the IL2RA locus.
19337309 2009 Specific association of a CLEC16A/KIAA0350 polymorphism with NOD2/CARD15(-) Crohn's disease patients.
19317741 2009 Autoimmune disease association signals in CIITA and KIAA0350 are not involved in celiac disease susceptibility.
19305408 2009 Common variants at ten loci influence QT interval duration in the QTGEN Study.
19264985 2009 Rare variants of IFIH1, a gene implicated in antiviral responses, protect against type 1 diabetes.
19221398 2010 Chromosomal region 16p13: further evidence of increased predisposition to immune diseases.
19178520 2009 Intron polymorphism in the KIAA0350 gene is reproducibly associated with susceptibility to type 1 diabetes (T1D) in the Han Chinese population.
19073967 2008 Shared and distinct genetic variants in type 1 diabetes and celiac disease.
18987646 2009 The expanding genetic overlap between multiple sclerosis and type I diabetes.
18978792 2008 Meta-analysis of genome-wide association study data identifies additional type 1 diabetes risk loci.
18946483 2009 Variation within the CLEC16A gene shows consistent disease association with both multiple sclerosis and type 1 diabetes in Sardinia.
18940880 2009 Association of type 1 diabetes with two Loci on 12q13 and 16p13 and the influence coexisting thyroid autoimmunity in Japanese.
18650830 2008 Replication of KIAA0350, IL2RA, RPL5 and CD58 as multiple sclerosis susceptibility genes in Australians.
18593762 2008 Polymorphisms in CLEC16A and CIITA at 16p13 are associated with primary adrenal insufficiency.
17660530 2007 Risk alleles for multiple sclerosis identified by a genomewide study.
17632545 2007 A genome-wide association study identifies KIAA0350 as a type 1 diabetes gene.
17554300 2007 Genome-wide association study of 14,000 cases of seven common diseases and 3,000 shared controls.
17554260 2007 Robust associations of four new chromosome regions from genome-wide analyses of type 1 diabetes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
9205841 1997 Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.