Property Summary

NCBI Gene PubMed Count 23
PubMed Score 34.72
PubTator Score 27.91

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
26564003 Data show that asymptomatic patients with unstable plaques exhibited higher levels of endothelial microparticles (EMPs), CXCL9 chemokine and stem cell growth factor; lymphocyte secreted C-type lectin (SCGF-beta) compared to those with stable plaques.
26440592 level of expression correlates with pain response in subjects with intervertebral disc disorders
23357302 This is the first report of SCGF beta in heart failure patients.
21943129 These studies highlight a possible role of SCGFalpha in imatinib-induced changes of gastrointestinal stromal tumors structure, consistent with a therapeutic response.
19884328 The results presented here demonstrate that homozygous T at -539 in the SCGF promoter is associated with elevated SCGF production, enhanced erythropoiesis, and protection against severe malarial anemia.
19528216 phagocytosis of hemozoin promotes a decrease in SCGF gene products, which may contribute to reduced erythropoiesis in children with severe malarial anemia.
19416273 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15234225 Human vascular smooth muscle cells express stem cell factor(SCF) and its receptor, c-kit. SCF is released from its membrane-bound form via MMP-9. SCF/c-kit signaling may affect SMC function via an autocrine pathway.
14746805 Results indicate that interleukin-4, together with recombinant human stem cell factor, can induce T cell maturation from cord blood progenitor cells, and that IL-4 increased the expression of FcepsilonRI on fetal liver mast cells.
11920266 SCGF is selectively produced by osseous and hematopoietic stromal cells, and can mediate their proliferative activity on primitive hematopoietic progenitor cells.

AA Sequence

MQAAWLLGALVVPQLLGFGHGARGAEREWEGGWGGAQEEEREREALMLKHLQEALGLPAGRGDENPAGTV      1 - 70
EGKEDWEMEEDQGEEEEEEATPTPSSGPSPSPTPEDIVTYILGRLAGLDAGLHQLHVRLHALDTRVVELT     71 - 140
QGLRQLRNAAGDTRDAVQALQEAQGRAEREHGRLEGCLKGLRLGHKCFLLSRDFEAQAAAQARCTARGGS    141 - 210
LAQPADRQQMEALTRYLRAALAPYNWPVWLGVHDRRAEGLYLFENGQRVSFFAWHRSPRPELGAQPSASP    211 - 280
HPLSPDQPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCEFPF                               281 - 323
//

Text Mined References (25)

PMID Year Title
26564003 2015 Elevated levels of endothelial-derived microparticles, and serum CXCL9 and SCGF-? are associated with unstable asymptomatic carotid plaques.
26440592 2015 Exploratory study for identifying systemic biomarkers that correlate with pain response in patients with intervertebral disc disorders.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23357302 2013 Prognostic value of circulating levels of stem cell growth factor beta (SCGF beta) in patients with Chagas' disease and idiopathic dilated cardiomyopathy.
21943129 2011 Proteomic detection of a large amount of SCGF? in the stroma of GISTs after imatinib therapy.
19884328 2010 A novel functional variant in the stem cell growth factor promoter protects against severe malarial anemia.
19528216 2009 Suppression of a novel hematopoietic mediator in children with severe malarial anemia.
19416273 2009 Association study between keratinocyte-derived growth factor gene polymorphisms and susceptibility to vitiligo vulgaris in a Taiwanese population: potential involvement of stem cell factor.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15234225 2004 Stem cell factor and c-kit are expressed by and may affect vascular SMCs through an autocrine pathway.
14746805 2003 Recombinant human (rh) stem cell factor and rhIL-4 stimulate differentiation and proliferation of CD3+ cells from umbilical cord blood and CD3+ cells enhance FcepsilonR1 expression on fetal liver-derived mast cells in the presence of rhIL-4.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12900775 2003 Serum stem cell growth factor for monitoring hematopoietic recovery following stem cell transplantation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11920266 2001 Stem cell growth factor: in situ hybridization analysis on the gene expression, molecular characterization and in vitro proliferative activity of a recombinant preparation on primitive hematopoietic progenitor cells.
11803813 2001 Expression of LSLCL, a new C-type lectin, is closely restricted, in bone marrow, to immature neutrophils.
10807776 2000 In vitro differentiation of endothelial cells from AC133-positive progenitor cells.
10198175 1999 Cloning, mapping, and genomic organization of the LSLCL gene, encoding a new lymphocytic secreted mucin-like protein with a C-type lectin domain: A new model of exon shuffling.
9705843 1998 Isolation and characterization of a cDNA for human mouse, and rat full-length stem cell growth factor, a new member of C-type lectin superfamily.
9442024 1998 Molecular cloning of a new secreted sulfated mucin-like protein with a C-type lectin domain that is expressed in lymphoblastic cells.
9207134 1997 Cloning, expression, and characterization of a cDNA encoding a novel human growth factor for primitive hematopoietic progenitor cells.
3304620 1987 Production of human hematopoietic survival and growth factor by a myeloid leukemia cell line (KPB-M15) and placenta as detected by a monoclonal antibody.