Property Summary

NCBI Gene PubMed Count 14
PubMed Score 104.65
PubTator Score 159.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
tuberculosis and treatment for 3 months 1.800 3.2e-05
non-small cell lung cancer -1.368 2.3e-16
intraductal papillary-mucinous carcinoma... -1.100 2.8e-03
interstitial cystitis 1.100 4.2e-02
ovarian cancer -1.800 3.4e-09

Gene RIF (9)

PMID Text
26172302 BRAF(V600E) mutation induces MGL ligand expression, thereby providing a direct link between oncogenic transformation and aberrant expression of immunosuppressive glycans in colorectal neoplasms.
26147970 These results indicate a role of MGL as an immunomodulator within the tumour microenvironment interfering with Treg functions, suggesting its possible use in the design of anticancer vaccines.
23918927 expression of GalNAc moieties mirrors the T cell activation status, and thus only highly stimulated T cells are prone to the suppressive action of MGL.
23744646 MGL triggering synergized with TLR2-induced pathways, leading to elevated IL-10 mRNA levels & enhanced TNF-alpha mRNA stability. It promoted phosphorylation of the ERK & CREB, fine-tuning the DC maturation phenotype.
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of C-type lectin domain family 10, member A (CLEC10A) in peptide-treated PBMCs
23275449 Described is the use of recombinant CLEC10A (CD301), a human glycoreceptor of the C-type lectin family, for the detection of ligands in sections from formalin-fixed, paraffin-embedded normal and cancerous mammary tissues.
22531918 MGL engagement improved DC performance as antigen-presenting cells, promoting the upregulation of maturation markers, a decrease in phagocytosis, an enhancement of motility, and most importantly an increase in antigen-specific CD8(+) T-cell activation.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19776380 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MTRTYENFQYLENKVKVQGFKNGPLPLQSLLQRLCSGPCHLLLSLGLGLLLLVIICVVGFQNSKFQRDLV      1 - 70
TLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPS     71 - 140
VCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQ    141 - 210
LKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGE    211 - 280
DCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESH                                      281 - 316
//

Text Mined References (15)

PMID Year Title
26172302 2015 MGL ligand expression is correlated to BRAF mutation and associated with poor survival of stage III colon cancer patients.
26147970 2015 The Macrophage Galactose-Type C-Type Lectin (MGL) Modulates Regulatory T Cell Functions.
23918927 2013 Human T cell activation results in extracellular signal-regulated kinase (ERK)-calcineurin-dependent exposure of Tn antigen on the cell surface and binding of the macrophage galactose-type lectin (MGL).
23744646 2013 MGL signaling augments TLR2-mediated responses for enhanced IL-10 and TNF-? secretion.
23275449 2013 Protein domain histochemistry (PDH): binding of the carbohydrate recognition domain (CRD) of recombinant human glycoreceptor CLEC10A (CD301) to formalin-fixed, paraffin-embedded breast cancer tissues.
22531918 2012 Targeting of macrophage galactose-type C-type lectin (MGL) induces DC signaling and activation.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19834553 2009 Variation of Neisseria gonorrhoeae lipooligosaccharide directs dendritic cell-induced T helper responses.
19776380 2009 Single nucleotide polymorphism of TAG-1 influences IVIg responsiveness of Japanese patients with CIDP.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8598452 1996 Molecular cloning and expression of cDNA encoding human macrophage C-type lectin. Its unique carbohydrate binding specificity for Tn antigen.