Claudin domain-containing protein 1

Property Summary

NCBI Gene PubMed Count	13
PubMed Score	5.02

PubTator Score	3.40

Knowledge Summary

Patent

No data available

TINX Plot

Disease (2)

Expression Atlas
JensenLab Experiment COSMIC

Disease	Target Count	P-value
non-small cell lung cancer	2890	2.1e-19
tuberculosis	2010	2.1e-06
malignant mesothelioma	3232	3.9e-06
ovarian cancer	8520	6.5e-06
ependymoma	4679	2.6e-05
osteosarcoma	7950	6.3e-05
atypical teratoid / rhabdoid tumor	5112	9.3e-05
Down syndrome	499	2.7e-04
lung adenocarcinoma	2716	2.8e-04
medulloblastoma, large-cell	6241	1.3e-03
subependymal giant cell astrocytoma	2287	2.5e-03
group 4 medulloblastoma	1855	6.0e-03
primary Sjogren syndrome	735	7.7e-03
spina bifida	1074	4.7e-02

Disease	Target Count	Z-score	Confidence
Carcinoma	11493	0.0	0.6

Differential Expression (14)

Disease	log2 FC	p
atypical teratoid / rhabdoid tumor	-1.300	9.3e-05
Down syndrome	1.800	2.7e-04
ependymoma	-1.100	2.6e-05
group 4 medulloblastoma	-1.300	6.0e-03
lung adenocarcinoma	1.222	2.8e-04
malignant mesothelioma	1.400	3.9e-06
medulloblastoma, large-cell	-1.600	1.3e-03
non-small cell lung cancer	-1.038	2.1e-19
osteosarcoma	-1.274	6.3e-05
ovarian cancer	-1.900	6.5e-06
primary Sjogren syndrome	1.100	7.7e-03
spina bifida	-1.083	4.7e-02
subependymal giant cell astrocytoma	-2.566	2.5e-03
tuberculosis	-1.100	2.1e-06

Brain - Spinal cord (cervical c-1) 17,973

Brain - Substantia nigra 17,981

Brain - Hippocampus 18,011

Brain - Hypothalamus 18,169

Brain - Putamen (basal ganglia) 17,863

Brain - Amygdala 18,006

Brain - Caudate (basal ganglia) 18,001

Cells - EBV-transformed lymphocytes 18,186

Nerve - Tibial 18,007

Uterus 17,618

Vagina 17,834

Brain - Frontal Cortex (BA9) 18,069

Brain - Nucleus accumbens (basal ganglia... 18,024

Ovary 17,971

Testis 18,518

Brain - Cerebellar Hemisphere 18,015

Artery - Coronary 17,949

Lung 18,057

Artery - Aorta 17,896

Artery - Tibial 17,631

Esophagus - Mucosa 18,076

Brain - Cortex 18,039

Brain - Cerebellum 17,983

Adipose - Visceral (Omentum) 17,937

Brain - Anterior cingulate cortex (BA24) 17,989

Colon - Sigmoid 18,089

Skin - Not Sun Exposed (Suprapubic) 18,081

Spleen 17,614

Esophagus - Gastroesophageal Junction 18,000

Thyroid 18,024

Esophagus - Muscularis 18,017

Stomach 17,879

Breast - Mammary Tissue 18,103

Prostate 18,213

Skin - Sun Exposed (Lower leg) 17,968

Adipose - Subcutaneous 18,110

Cells - Transformed fibroblasts 17,577

Small Intestine - Terminal Ileum 17,954

Colon - Transverse 17,825

Pituitary 18,147

Heart - Atrial Appendage 17,896

Adrenal Gland 18,071

Minor Salivary Gland 18,005

Whole Blood 17,439

Kidney - Cortex 17,329

Heart - Left Ventricle 18,006

Muscle - Skeletal 17,778

Liver 18,071

Pancreas 18,123

Adult Spinal Cord 7,594

Adult Frontal Cortex 9,048

Adult Testis 10,836

Adult Ovary 10,192

Fetal Brain 7,866

Adult Liver 9,113

B Cells 9,086

Adult Urinary Bladder 7,592

Adult Prostate 8,952

Fetal Ovary 9,118

Adult Rectum 8,022

Adult Pancreas 9,168

CD8 Cells 9,840

Adult Retina 10,115

Brain

Frontal lobe

Liver

B-lymphocyte

Ovary

Pancreas

Prostate gland

Rectum

Retina

Spinal cord

Testis

Urinary bladder

BTO:0004410

adipose tissue 15,837

adrenal gland 15,963

appendix 16,247

bone marrow 14,571

breast 16,063

cerebral cortex 16,630

cervix, uterine 15,871

colon 15,959

duodenum 15,975

endometrium 16,349

epididymis 15,863

esophagus 15,898

fallopian tube 16,245

gallbladder 16,333

heart muscle 14,972

kidney 15,917

liver 14,587

lung 16,312

lymph node 15,833

ovary 15,408

pancreas 14,070

parathyroid gland 14,769

placenta 15,937

prostate 16,460

rectum 15,705

salivary gland 14,981

seminal vesicle 15,918

skeletal muscle 14,011

skin 16,206

small intestine 16,154

smooth muscle 15,857

spleen 15,972

stomach 16,099

testis 17,936

thyroid gland 15,959

tonsil 15,400

urinary bladder 15,814

Liver and Pancreas 16,750

Digestive Tract 17,369

Urinary Tract 16,678

Endocrine System 18,159

Blood and immune system 16,909

Respiratory system 16,393

Female tissues 17,400

Male tissues 17,142

Skin and soft tissues 17,230

Nervous System 16,725

Cardiovascular System 15,192

Brain 7,346

Teratocarcinoma cell 604

Eye 856

Hippocampus 531

Liver 5,008

Spinal cord 74

T-cell chronic lymphocytic leukemia cell 2,346

Umbilical cord blood 344

See source...

Brain endothelial cell 3

BT-549 cell 7

See source...

Synonym

Accession	Q9NY35 B3KQR1 D3DN36 F2Z2D9 Q502Y8 Q6UVX2 Q9BUZ9 Q9NZZ5 Q9Y4S9
Symbols	Z38 C3orf4 GENX-3745

Gene

CLDND1

Ortholog (11)

Species	Source	Disease
Pig 10,168	Inparanoid OMA
Opossum 12,230	Inparanoid OMA
Platypus 5,703	Inparanoid OMA
Anole lizard 10,588	Inparanoid OMA
Xenopus 10,468	Inparanoid OMA
Macaque 12,761	Inparanoid OMA
Mouse 16,570	Inparanoid OMA
Rat 15,117	Inparanoid OMA
Dog 15,073	Inparanoid OMA
Horse 14,252	Inparanoid OMA
Cow 15,320	Inparanoid OMA

UniProt Keyword (7)

Complete proteome 20,231

Reference proteome 20,231

Alternative splicing 10,528

Glycoprotein 4,623

Membrane 7,361

Transmembrane 5,228

Transmembrane helix 5,207

GO Component (2)

integral component of membrane 3,665

cell surface 608

Compartment GO Term (12)

Cell 16,178

Cell part 16,177

Cell periphery 5,382

Cytosol 6,686

Integral component of membrane 5,331

Intrinsic component of membrane 5,458

Membrane 8,531

Membrane part 6,554

Nucleoli 942

Nucleus 7,562

Plasma membrane 5,830

cellular_component 18,320

GWAS Trait (1)

Post bronchodilator FEV1-FVC ratio 308

HCA RNA Cell Line (56)

A-431 16,131

A549 15,174

AF22 16,160

AN3-CA 15,648

ASC TERT1 14,842

BEWO 16,726

BJ 15,448

BJ hTERT+ 15,353

BJ hTERT+ SV40 Large T+ 15,609

BJ hTERT+ SV40 Large T+ RasG12V 15,493

See all...

Protein-protein Interaction (9)

GOLGA7 KIAA2013 MAN1A1 MAN1A2 ZDHHC8 ZDHHC5 B4GALT4 MT-CYB BMPR1A

Gene RIF (4)

AA Sequence

MDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPVQENSSDLNKSIWDEFISDEADEKTYNDALFR      1 - 70
YNGTVGLWRRCITIPKNMHWYSPPERTESFDVVTKCVSFTLTEQFMEKFVDPGNHNSGIDLLRTYLWRCQ     71 - 140
FLLPFVSLGLMCFGALIGLCACICRSLYPTIATGILHLLAGLCTLGSVSCYVAGIELLHQKLELPDNVSG    141 - 210
EFGWSFCLACVSAPLQFMASALFIWAAHTNRKEYTLMKAYRVA                               211 - 253
//

Text Mined References (17)

Summary
Details

	PMID	Year	Title

Tbio Claudin domain-containing protein 1 Add to cart View Collections Empty Collection