Property Summary

NCBI Gene PubMed Count 25
PubMed Score 6.84
PubTator Score 8.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Prostatic Neoplasms 471
Disease Target Count P-value
pituitary cancer 1972 5.5e-04

Expression

  Differential Expression (1)

Disease log2 FC p
pituitary cancer 1.100 5.5e-04

Gene RIF (10)

PMID Text
26464708 the expression of claudin-5 and claudin-9 was down-regulated while the expression of claudin-8 was up-regulated in cervical carcinoma tissues compared with adjacent non-neoplastic tissues.
25281028 CLDN9 may be an important biomarker for invasive pituitary oncocytomas.
23864633 Although claudin-6 and claudin-9 can serve as entry factors in cell lines, hepatitis C virus infection into human hepatocytes is not dependent on claudin-6 and claudin-9.
20874001 Increased expression of claudin-6, claudin-7, or claudin-9 is sufficient to enhance tumorigenic properties of a gastric adenocarcinoma cell line.
19960275 Claudins 6, 7, and 9 expressions are closely related to gastric carcinogenesis.
19773279 Observational study of gene-disease association. (HuGE Navigator)
19696885 Mouse studies suggest that claudin-9 deficiency may cause hearing loss not only in mice but also in humans.
18234789 claudin-6 and claudin-9 expressed in CD81+ cells also enable the entry of HCV pseudoparticles derived from six of the major genotypes.
17804490 Residues N38 and V45 in the first extracellular loop (EL1) of CLDN9 are necessary for HCV entry.
12736707 CLDN9, clustered with CLDN6 at human chromosome 16p13.3, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.

AA Sequence

MASTGLELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSL      1 - 70
LALPQDLQAARALCVIALLLALLGLLVAITGAQCTTCVEDEGAKARIVLTAGVILLLAGILVLIPVCWTA     71 - 140
HAIIQDFYNPLVAEALKRELGASLYLGWAAAALLMLGGGLLCCTCPPPQVERPRGPRLGYSIPSRSGASG    141 - 210
LDKRDYV                                                                   211 - 217
//

Text Mined References (25)

PMID Year Title
26464708 2015 Expression of claudin-5, -7, -8 and -9 in cervical carcinoma tissues and adjacent non-neoplastic tissues.
25281028 2014 Overexpression of the cell adhesion molecule claudin-9 is associated with invasion in pituitary oncocytomas.
23864633 2013 Functional analysis of claudin-6 and claudin-9 as entry factors for hepatitis C virus infection of human hepatocytes by using monoclonal antibodies.
20874001 2011 Claudin-6, 7, or 9 overexpression in the human gastric adenocarcinoma cell line AGS increases its invasiveness, migration, and proliferation rate.
19960275 2010 Distribution and expression pattern of claudins 6, 7, and 9 in diffuse- and intestinal-type gastric adenocarcinomas.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19706201 2009 The claudins.
19696885 2009 A claudin-9-based ion permeability barrier is essential for hearing.
18234789 2008 The tight junction proteins claudin-1, -6, and -9 are entry cofactors for hepatitis C virus.
18036336 2008 Structure and function of claudins.
17804490 2007 Claudin-6 and claudin-9 function as additional coreceptors for hepatitis C virus.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14698084 2004 Expression patterns of claudins, tight junction adhesion molecules, in the inner ear.
12742348 2003 Tight junction-related protein expression and distribution in human corneal epithelium.
12736707 2003 CLDN23 gene, frequently down-regulated in intestinal-type gastric cancer, is a novel member of CLAUDIN gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475568 2003 Tight junction proteins.
12231346 2002 Claudin-based barrier in simple and stratified cellular sheets.
11912246 2002 Differential expression patterns of claudins, tight junction membrane proteins, in mouse nephron segments.
11283726 2001 Multifunctional strands in tight junctions.
11247307 2001 The roles of claudin superfamily proteins in paracellular transport.
11095601 2000 Corneal epithelial tight junctions and their response to lipopolysaccharide challenge.
10690502 2000 Tight junctions of the blood-brain barrier.
9441748 1997 Analysis of a human gene homologous to rat ventral prostate.1 protein.