Property Summary

NCBI Gene PubMed Count 29
PubMed Score 24.61
PubTator Score 18.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
urothelial carcinoma -1.300 2.6e-02
psoriasis -3.000 9.2e-15
ulcerative colitis -4.600 9.0e-06
colon cancer -5.600 1.5e-14
active Crohn's disease -2.762 2.9e-02
cystic fibrosis -3.200 1.0e-05
Breast cancer -4.400 2.0e-16
breast carcinoma -2.300 8.1e-24

Gene RIF (8)

PMID Text
26560196 High Claudin 8 Contributes to Malignant Proliferation in Osteosarcoma.
26464708 the expression of claudin-5 and claudin-9 was down-regulated while the expression of claudin-8 was up-regulated in cervical carcinoma tissues compared with adjacent non-neoplastic tissues.
23322640 Human Cldn-8 and -14 were shown to convey Clostridium perfringens enterotoxin-mediated cytotoxicity at pathophysiologically relevant concentrations of this toxin, although ~2-to-10-fold less efficiently than Cldn-4.
19302533 the combination of CK7, S100A1 and claudin 8 immunohistochemistry can be useful for classifying tumours of overlapping histology as chromophobe renal cell carcinoma or renal oncocytomas.
19000657 Na(+) absorption is paralleled by claudin-8-mediated sealing of the paracellular barrier to prevent Na(+) back-leakage, supporting steep Na(+) gradients in distal colon.
18799195 claudin-7 and claudin-8 have potential use as immunohistochemical biomarkers in the differential diagnosis of chromophobe renal cell carcinoma and oncocytoma
17047970 Differential expression of genes encoding claudins in colorectal cancer suggests that these tight junction proteins may be associated to and involved in tumorigenesis.
12736707 CLDN8, clustered with CLDN17 at human chromosome 21q22.11, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.

AA Sequence

MATHALEIAGLFLGGVGMVGTVAVTVMPQWRVSAFIENNIVVFENFWEGLWMNCVRQANIRMQCKIYDSL      1 - 70
LALSPDLQAARGLMCAASVMSFLAFMMAILGMKCTRCTGDNEKVKAHILLTAGIIFIITGMVVLIPVSWV     71 - 140
ANAIIRDFYNSIVNVAQKRELGEALYLGWTTALVLIVGGALFCCVFCCNEKSSSYRYSIPSHRTTQKSYH    141 - 210
TGKKSPSVYSRSQYV                                                           211 - 225
//

Text Mined References (31)

PMID Year Title
26560196 2015 Claudin 8 Contributes to Malignant Proliferation in Human Osteosarcoma U2OS Cells.
26464708 2015 Expression of claudin-5, -7, -8 and -9 in cervical carcinoma tissues and adjacent non-neoplastic tissues.
25416956 2014 A proteome-scale map of the human interactome network.
23322640 2013 Human claudin-8 and -14 are receptors capable of conveying the cytotoxic effects of Clostridium perfringens enterotoxin.
22042635 2012 Antibody-based protein profiling of the human chromosome 21.
20339536 2010 Genome-wide association of lipid-lowering response to statins in combined study populations.
19924644 2010 Claudins in human cancer: a review.
19706201 2009 The claudins.
19302533 2009 Immunohistochemical stain for cytokeratin 7, S100A1 and claudin 8 is valuable in differential diagnosis of chromophobe renal cell carcinoma from renal oncocytoma.
19000657 2009 Na+ absorption defends from paracellular back-leakage by claudin-8 upregulation.
18799195 2009 Claudin-7 and claudin-8: immunohistochemical markers for the differential diagnosis of chromophobe renal cell carcinoma and renal oncocytoma.
18036336 2008 Structure and function of claudins.
17287494 2007 Gene expression profiling and its relevance to the blood-epididymal barrier in the human epididymis.
17047970 2007 Differential expression of genes encoding tight junction proteins in colorectal cancer: frequent dysregulation of claudin-1, -8 and -12.
16780588 2006 Cell array-based intracellular localization screening reveals novel functional features of human chromosome 21 proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12736707 2003 CLDN23 gene, frequently down-regulated in intestinal-type gastric cancer, is a novel member of CLAUDIN gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475568 2003 Tight junction proteins.
12231346 2002 Claudin-based barrier in simple and stratified cellular sheets.
12067061 2002 Organization and formation of the tight junction system in human epidermis and cultured keratinocytes.
11283726 2001 Multifunctional strands in tight junctions.
11247307 2001 The roles of claudin superfamily proteins in paracellular transport.
10830953 2000 The DNA sequence of human chromosome 21.
10690502 2000 Tight junctions of the blood-brain barrier.
10601346 1999 Direct binding of three tight junction-associated MAGUKs, ZO-1, ZO-2, and ZO-3, with the COOH termini of claudins.
9892664 1999 Claudin multigene family encoding four-transmembrane domain protein components of tight junction strands.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.