Property Summary

NCBI Gene PubMed Count 121
PubMed Score 337.80
PubTator Score 247.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 1.600 2.8e-07
osteosarcoma 1.824 5.4e-07
intraductal papillary-mucinous carcinoma... 2.200 8.6e-03
intraductal papillary-mucinous neoplasm ... 1.800 1.2e-03
pancreatic cancer 1.700 1.5e-07
interstitial cystitis -1.900 7.5e-04
lung adenocarcinoma 1.461 9.9e-05
gastric carcinoma 2.900 1.8e-02
ductal carcinoma in situ 1.100 4.7e-02
invasive ductal carcinoma 1.600 2.0e-03
ovarian cancer 2.800 2.7e-11

Gene RIF (102)

PMID Text
26616722 that claudin-4 can be helpful at least in making a reliable differential diagnosis of spiradenoma when overlapping morphologic features do not allow to further subclassification in the overwhelming variety of the adnexal tumors.
26319240 claudin 1 and claudin 4 are differentially involved in atopic dermatitis pathogenesis
26109060 This meta-analysis shows that over-expression of claudin-4 is associated with progress of gastric cancer and poor prognosis of gastric cancer patients.
26058359 Results suggested that claudin-4, which was regulated by methylation status, plays an important role in breast cancer growth and malignancy via the control of cell proliferation, migration and apoptosis.
26043767 Results showed overexpression of CLDN4 in endometrial cancer cells. Its intracellular presence coupled with the biphasic effects of E2 on its expression in the cytoskeleton suggest that it may be involved in cell signaling to and from tight junctions.
25964581 Our results indicate that CLDN4 expression is correlated with poor prognosis, and CLDN1 expression may be an indicator of recurrence of oral squamous cell carcinoma.
25871476 Overexpression of claudin-4 induced formation of vascular channels in breast cancer.
25778318 Increased claudin 4 expression was related to advanced stage and decreased survival in nasopharyngeal carcinoma.
25755790 increased claudin-3 and claudin-4 expression may play a postive role in the progression and metastasis of gastric cancer
25697377 Data suggest that changes in DNA methylation in trophoblasts regulate (1) cell mobility/placentation, (2) expression of claudin-4 (CLDN4) and 4-fucosyltransferase (FUT4), and (3) matrix metalloproteinase (MMP2 and MMP9) activity.
25449274 upregulation of claudin-4 expression regulated by DeltaNp63 might be associated with complementary or repair responses of damaged keratinocytes with atopic dermatitis
25417118 Claudin-4 is frequently expressed in primary breast cancers but especially in their metastases and is thereby an attractive membrane bound molecular imaging and drug target.
25344320 Claudin-4 controls the receptor tyrosine kinase EphA2 pro-oncogenic switch through beta-catenin
25038829 Claudin 1, 4, and 7 are important building blocks of paracellular adhesion molecules; their decreased expression in colorectal cancer seems to have critical effects on cell proliferation, motility, invasion, and immune response against the tumor.
25031428 Claudins 2 and 4 have reciprocal effects on epithelial barrier function, exhibit differential FRAP dynamics, and compete for residency within the tight junction.
24840331 The exposure to HIV-1 or HIV-1 gp120 results in a significant downregulation of tight junction proteins ZO-1, Occludin, Claudin-1, Claudin-2, Claudin-3, Claudin-4, and Claudin-5 in human retinal pigment epithelial cells
24815833 The present study demonstrates that high expression of claudins 1, 4, 5 and down-regulation of claudin-7 are positive prognostic markers and are associated with good outcome and increased survival rates.
24737165 Data show that claudin-4 and claudin-7 were observed in hepatocytes of severely damaged mouse and human livers.
24737010 Low expression of claudin-4 is associated with recurrence in esophageal squamous cell carcinoma.
24421209 Claudin-4 immunohistochemistry effectively distinguishes adenocarcinoma from malignant mesothelioma with high sensitivity and specificity in the evaluation of malignant effusions.
24304426 twist and zeb1 are involved in placental maturation, whereas claudin 4 appears to be connected with placental diseases such as diabetes, toxaemia or molar disease.
24073800 The degradation of claudin-3 and claudin-4 induced by acidic stress could be attenuated by specific TRPV1 blockers.
23822740 High claudin-4 expression is associated with gastric carcinoma.
23775021 Claudin-4 was very useful marker for distinguishing mesothelioma and adenocarcinoma
23685873 Studies suggest that claudin-3 and claudin-4 might be targets for the treatment of chemotherapy-resistant ovarian cancer and other tumors overexpressing claudin-3 and -4 using Clostridium perfringens enterotoxin (CPE)-based theranostic agents.
23668053 Exceedingly high levels of CLDN4 might negatively influence fertility rates.
23596113 Claudin-4 is a highly specific and sensitive immunohistochemical marker for assisting in distinguishing epithelioid mesotheliomas from metastatic carcinomas to the serosal membranes.
23521713 Knockdown of claudin-4 inhibited cell motility and the mimic peptide had no effect on motility in the claudin-4 knockdown cells.
23503645 claudin-4 and PAX8 have a higher sensitivity and specificity for discriminating between pleural epithelioid mesotheliomas and renal cell carcinomas compared with other positive carcinoma markers
23196794 PAX8 and claudin-4 have a higher sensitivity and specificity for assisting in discriminating between peritoneal epithelioid mesotheliomas and serous carcinomas when compared with all of the other positive carcinoma markers
23097631 High CLDN4 expression is associated with tumor growth and metastases.
23095775 Altered claudin-4 expression in progesterone-treated endometrial adenocarcinoma cell line Ishikawa.
23053666 Claudin-3(CLDN3) and claudin-4 (CLDN4) affect sensitivity of the ovarian cancer cells to the cytotoxic effect of cisplatin by regulating expression of the Cu transporter CTR1.
22898551 Modeling the "airway reopening" process, examined consequent increases in pulmonary epithelial plasma membrane rupture, paracellular permeability, and disruption of the tight junction proteins zonula occludens-1 and claudin-4.
22883527 Progesterone could inhibit the growth of Ishikawa cells by decreasing the expression of claudin-4.
22668877 these results indicate that Twist1 induces the repression of claudin-4 expression during the epithelial-mesenchymal transition in esophageal carcinoma.
22286027 This review focus is on the role of claudin-4, an integral constituent of tight junctions, in the pathophysiology of epithelial malignancies with particular focus pancreatic cancer. [review]
22128179 Mechanism of Clostridium perfringens enterotoxin interaction with claudin-3/-4 protein suggests structural modifications of the toxin to target specific claudins
21968969 Crude apple extract induces a higher paracellular resistance in differentiated Caco-2 cells, including claudin 4 expression.
21683675 Prostaglandin E2 produced by Entamoeba histolytica signals via EP4 receptor and alters claudin-4 to increase ion permeability of tight junctions
21508375 Claudin-4 expression was significantly greater in ovarian cancer tissue from chemoresistant patients compared to chemosensitive patients.
21493012 Claudin-1 and 4 expressions were found to be significantly lower in cases of colon carcinoma with lymph node metastasis.
21339813 The Claudin-displaying Baculovirus system may be a promising method to produce a novel Claudin binder and modulator.
21206985 High claudin 4 is associated with intraductal papillary mucinous neoplasms of the pancreas.
21102412 Suggest that claudin-4 expression is associated with neoplastic progression of intraductal papillary mucinous neoplasms of the pancreas and, especially, with a distinct pathway to intestinal differentiation.
20839069 Low expression of claudin-4 is associated with esophageal squamous cell carcinoma.
20478039 Claudin-1, -3, -4, -5, and -7 are expressed in developing human lung from week 12 to week 40 with distinct locations and in divergent quantities.
20466674 no mutations in CLDN3, CLDN4 and TRPV6 were found in Idiopathic infantile hypercalcaemia patients.
20204275 claudin-4 was expressed in all 18 cases of Epstein-Barr virus-associated nasopharyngeal carcinoma studied
20175704 claudin 4 is a biological tumor marker for cancer diagnosis
20163034 Results suggest that claudin-4 expression is upregulated in premalignant gastric alterations.
20086175 Results indicate that cells underwent EMT exhibited overactive TGFbeta signaling and loss of expression of the CDH1, CGN, CLDN4, and KLK10 genes as a result of hypermethylation of their corresponding promoter regions.
20070312 Helicobacter pylori disrupts gastric epithelial barrier structure via IL-1RI-dependent activation of ROCK, which in turn mediates tight junctional claudin-4 disruption.
20053926 there was no dramatic qualititative difference in the BCC or RMS tumors associated with the mutant Blm genotype
19903817 An electrostatic attraction between the basic claudin region and the acidic Clostridium perfringens enterotoxin cleft is involved in their interaction.
19884339 The role of claudin 4 in binding to Clostridium perfringens enterotoxin and its subsequent cytotoxicity are reported.
19661441 is altered in early-stage psoriasis
19657234 Data suggest a novel function for claudin-4 in cancer and provide an additional rationale for its common overexpression in human tumors.
19619303 claudin-4 can be released from ovarian cancer cells and can be detected in the peripheral circulation of ovarian cancer patients
19447895 changes in alveolar epithelial claudin expression influence paracellular transport, alveolar fluid clearance rates, and susceptibility to pulmonary edema
19390931 Downregulation of claudin-4 correlates with gastric cancer aggressiveness.
19374770 CLDN4 has a role in the optimization of the endometrium for embryo implantation.
19231096 claudin-4, in addition to 1 and 5, might be a useful differential diagnostic marker of lung cancer in Korean people.
19184060 Tight junction proteins claudin-1, claudin-3, claudin-4, and the adherens junction protein beta-catenin are overexpressed in colorectal carcinoma.
19180924 The expressions of PSCA and Claudin-4 are upregulated in the pancreatic carcinomas.
19142967 Increased claudin-4 expression is associated with breast cancer.
19120888 Down-regulation of claudin-4 might lead to altered tight junction structure and be related to the impaired epithelial function in active ulcerative colitis.
19082451 The expression of claudins-2, -3 and -4 in 16 rectal well-differentiated endocrine neoplasms was studied
19035134 Down-regulated expression of claudin-4 might play a pathogenic role in the formation of endometriosis.
18954444 Claudin 4 is downregulated in lobular carcinoma in situ compated with normal breast epithelium and stroma.
18786529 We found that claudin-4 contains a sequence which is phosphorylated by atypical PKC (aPKC). These findings suggest that aPKC regulates tight junction formation through the phosphorylation of claudin-4.
18752049 High CLDN4 is associated with basal-like breast carcinomas.
18648369 Claudin-4, coding for an integral membrane cell-junction protein, was the most significantly (P<0.00001) upregulated marker in both primary and metastatic tumour specimens compared with benign prostatic hyperplasia at both RNA and protein levels
18550469 Claudins 1 and 4 expression was significantly associated with stage in patients with urothelial carcinoma of the upper urinary tract.
18538010 The exposure to HIV-1 or HIV-1 gp120 results in a significant downregulation of tight junction proteins ZO-1, Occludin, Claudin-1, Claudin-2, Claudin-3, Claudin-4, and Claudin-5 in human retinal pigment epithelial cells
18477216 Early gastric carcinomas demonstrating I-CLDN(+) phenotype have a high risk of synchronous and metachronous secondary gastric epithelial neoplasias.
18384777 Down-regulated expression of claudin-3 and claudin-4 in ectopic endometrium suggests that claudin-3 and claudin-4 might play a pathogenic role in the formation of endometriosis.
18313739 Increased expression of claudin-3 and claudin-4 may contribute to aggressive phenotype of endometrial cancer of serous papillary or clear-cell histology. Possible targets for therapeutic intervention.
18283635 MMP-2, MMP-9 and claudin-4 expression may be phenotypic features, distinguishing intestinal-type and diffuse-type gastric cancer.
18251778 Cdx2 plays an important role in the regulation of intestinal claudin expression not only in gastric mucosa with intestinal metaplasia but also gastric carcinoma.
17962811 Reduced claudin-4 expression correlates with loss of differentiation in thyroid neoplasms.
17709988 vinculin plays a role in growth regulation of neuroendocrine tumors and in expression of CLD4
17678893 The modulation of claudin-4 activity by PKCepsilon may not only provide a mechanism for disrupting TJ function in ovarian cancer, but may also be important in the regulation of TJ function in normal epithelial cells.
17651017 Our data suggest that JUND and CLDN4 are critical mediators of the antiproliferative and antiviral effects of type I IFNs and further confirm the functional importance of the DNA-binding domain of Stat2.
17545541 Claudin-3 and claudin-4 receptors are highly overexpressed in carcinosarcoma
17459057 Loss of claudin expression may enhance the grade of malignancy of gastric cancer in vivo.
17418912 When compared, small-cell-lung cancers and carcinoid tumors, adenocarcinomas, and squamous cell carcinomas in CLDN4 expression.
17359339 Tight junction proteins contribute to the permeability barrier in epidermal keratinocytes
17326053 Overexpression of claudin-4 is associated with uterine serous papillary carcinoma
16969486 expression of claudin-4 is lower in diffuse-type gastric cancer than in intestinal-type gastric cancer
16949040 WNK1 increases paracellular chloride permeability and phosphorylation of claudin-4
16714763 Sp1 epigenetic modifications have a critical role in regulation of the CLDN4 promoter in ovarian cancer cells
16439986 Claudin-4 expression seems to be a useful marker in differentiating biliary tract cancers from hepatocellular carcinomas and could well become a potential diagnostic tool.
16287068 claudin 3 and claudin 4 may play a role in transformation of ovarian surface epithelium towards the malignant phenotype
16253248 The expression of claudin-1, -3 and -4 was upregulated 5.7-, 1.5- and 2.4-fold, respectively, in colorectal tumor tissues in comparison to the normal ones.
16236711 tyrosine phosphorylation of claudin-4 attenuates association of claudin-4 with ZO-1, decreasing integration of claudin-4 into sites of cell-cell contact and enhancing paracellular permeability
15743508 loss of CLDN4 expression in areas of apocrine metaplasia and in the majority of grade 1 invasive carcinomas suggests a particular role for this protein in mammary glandular cell differentiation and carcinogenesis
15643498 claudin 4 may play a role in the disruption of cell-to-cell adhesion in diffuse type gastric cancer and in a loss of differentiation.
15366421 The tail of claudin-2 could stabilize claudin-4, with a concomitant increase in both protein level and physiologic influence.
14559813 Claudin-4 is a potent inhibitor of the invasiveness and metastatic phenotype of pancreatic cancer cells, and a target of the transforming growth factor beta and Ras/Raf/extracellular signal-regulated kinase pathways.
12736707 CLDN4, clustered with CLDN3 at human chromosome 7q11, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.
12700140 Results support a model in which claudins 2 and 4 create paracellular channels and the first extracellular domain is sufficient to determine both paracellular charge selectivity and transepithelial electrical resistance.

AA Sequence

MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSL      1 - 70
LALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTA     71 - 140
HNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV     141 - 209
//

Text Mined References (122)

PMID Year Title
26616722 2016 Distinctive immunostaining of claudin-4 in spiradenomas.
26319240 2015 Diverse regulation of claudin-1 and claudin-4 in atopic dermatitis.
26109060 2015 Prognostic and clinical significance of claudin-4 in gastric cancer: a meta-analysis.
26058359 2015 Claudin-4 controls the proliferation, apoptosis, migration and in vivo growth of MCF-7 breast cancer cells.
26043767 2015 Estrogen-dependent expression and subcellular localization of the tight junction protein claudin-4 in HEC-1A endometrial cancer cells.
25964581 2015 The prognostic role of claudins -1 and -4 in oral squamous cell carcinoma.
25871476 2015 Claudin-4 is required for vasculogenic mimicry formation in human breast cancer cells.
25778318 Expression patterns of claudins 1, 4, and 7 and their prognostic significance in nasopharyngeal carcinoma.
25755790 2015 The expression patterns of tight junction protein claudin-1, -3, and -4 in human gastric neoplasms and adjacent non-neoplastic tissues.
25697377 2015 Genome-wide DNA methylation identifies trophoblast invasion-related genes: Claudin-4 and Fucosyltransferase IV control mobility via altering matrix metalloproteinase activity.
25449274 2014 Tight junction protein claudin-4 is modulated via ?Np63 in human keratinocytes.
25417118 2014 Upregulation of Claudin-4, CAIX and GLUT-1 in distant breast cancer metastases.
25344320 2014 Claudin-4 controls the receptor tyrosine kinase EphA2 pro-oncogenic switch through ?-catenin.
25038829 2014 Loss of tight junction proteins (Claudin 1, 4, and 7) correlates with aggressive behavior in colorectal carcinoma.
25031428 2014 Proinflammatory cytokine-induced tight junction remodeling through dynamic self-assembly of claudins.
24815833 Expression of claudins-1, -4, -5, -7 and occludin in hepatocellular carcinoma and their relation with classic clinicopathological features and patients' survival.
24737165 2015 Aberrant expression of claudin-4 and -7 in hepatocytes in the cirrhotic human liver.
24737010 2014 Low expression of claudin-4: an indicator of recurrence in esophageal squamous cell carcinoma after Ivor Lewis esophagectomy?
24421209 2014 Claudin-4 immunohistochemistry is highly effective in distinguishing adenocarcinoma from malignant mesothelioma in effusion cytology.
24304426 2014 A survey of zeb1, twist and claudin 1 and 4 expression during placental development and disease.
24073800 2013 The degradation of airway tight junction protein under acidic conditions is probably mediated by transient receptor potential vanilloid 1 receptor.
23822740 2013 Clinicopathological significance of claudin-4 in gastric carcinoma.
23775021 2013 Claudin-4 as a marker for distinguishing malignant mesothelioma from lung carcinoma and serous adenocarcinoma.
23685873 2013 Claudins overexpression in ovarian cancer: potential targets for Clostridium Perfringens Enterotoxin (CPE) based diagnosis and therapy.
23668053 2013 Aberrant claudin-4 transcript levels in eutopic endometrium of women with idiopathic infertility and minimal endometriosis.
23596113 2013 Value of claudin-4 immunostaining in the diagnosis of mesothelioma.
23521713 2013 Claudins play a role in normal and tumor cell motility.
23503645 2013 Value of PAX8, PAX2, napsin A, carbonic anhydrase IX, and claudin-4 immunostaining in distinguishing pleural epithelioid mesothelioma from metastatic renal cell carcinoma.
23407391 2013 Contribution of tight junction proteins to ion, macromolecule, and water barrier in keratinocytes.
23196794 2013 Value of PAX8, PAX2, claudin-4, and h-caldesmon immunostaining in distinguishing peritoneal epithelioid mesotheliomas from serous carcinomas.
23097631 2012 Tight junction proteins claudin-3 and claudin-4 control tumor growth and metastases.
23095775 2012 Altered claudin-4 expression in progesterone-treated endometrial adenocarcinoma cell line Ishikawa.
23053666 2013 Claudin-3 and claudin-4 regulate sensitivity to cisplatin by controlling expression of the copper and cisplatin influx transporter CTR1.
22898551 2012 Atelectrauma disrupts pulmonary epithelial barrier integrity and alters the distribution of tight junction proteins ZO-1 and claudin 4.
22883527 2012 [Regulation of claudin-4 gene expression in endometrial adenocarcinoma Ishikawa cell line by progesterone].
22668877 2012 Twist1 causes the transcriptional repression of claudin-4 with prognostic significance in esophageal cancer.
22286027 2012 Claudin-4 as therapeutic target in cancer.
22128179 2012 Mechanism of Clostridium perfringens enterotoxin interaction with claudin-3/-4 protein suggests structural modifications of the toxin to target specific claudins.
21968969 2012 Apple extract induces increased epithelial resistance and claudin 4 expression in Caco-2 cells.
21683675 2011 Prostaglandin E2 produced by Entamoeba histolytica signals via EP4 receptor and alters claudin-4 to increase ion permeability of tight junctions.
21508375 2011 Claudin-4: a potential therapeutic target in chemotherapy-resistant ovarian cancer.
21493012 2011 Prognostic importance of Claudin-1 and Claudin-4 expression in colon carcinomas.
21339813 2011 A novel screening system for claudin binder using baculoviral display.
21269460 2011 Initial characterization of the human central proteome.
21206985 2011 Immunohistochemical analysis of claudin expression in pancreatic cystic tumors.
21102412 2011 Expression of claudin-4 (CLDN4) mRNA in intraductal papillary mucinous neoplasms of the pancreas.
20839069 2011 Low expression of claudin-4 is associated with poor prognosis in esophageal squamous cell carcinoma.
20478039 2010 Divergent expression of claudin -1, -3, -4, -5 and -7 in developing human lung.
20466674 2010 Involvement of claudin 3 and claudin 4 in idiopathic infantile hypercalcaemia: a novel hypothesis?
20204275 2010 Claudin expression profiles in Epstein-Barr virus-associated nasopharyngeal carcinoma.
20175704 2010 Improvement of malignant serous effusions diagnosis by quantitative analysis of molecular claudin 4 expression.
20163034 Expression of claudin-4 and beta-catenin in gastric premalignant lesions.
20086175 2010 Smad signaling is required to maintain epigenetic silencing during breast cancer progression.
20070312 2010 Interleukin-1 receptor phosphorylation activates Rho kinase to disrupt human gastric tight junctional claudin-4 during Helicobacter pylori infection.
20053926 2010 Derepression of CLDN3 and CLDN4 during ovarian tumorigenesis is associated with loss of repressive histone modifications.
19924644 2010 Claudins in human cancer: a review.
19903817 2010 Clostridium perfringens enterotoxin interacts with claudins via electrostatic attraction.
19884339 2010 Identification of a claudin-4 residue important for mediating the host cell binding and action of Clostridium perfringens enterotoxin.
19706201 2009 The claudins.
19661441 2009 Alteration of tight junction proteins is an early event in psoriasis: putative involvement of proinflammatory cytokines.
19657234 2009 Possible angiogenic roles for claudin-4 in ovarian cancer.
19619303 2009 Claudin-containing exosomes in the peripheral circulation of women with ovarian cancer.
19447895 2009 Claudin-4 augments alveolar epithelial barrier function and is induced in acute lung injury.
19390931 2009 Expression of tight-junction-associated proteins in human gastric cancer: downregulation of claudin-4 correlates with tumor aggressiveness and survival.
19374770 2009 Endometrial claudin-4 and leukemia inhibitory factor are associated with assisted reproduction outcome.
19231096 2009 Diagnostic utility of expression of claudins in non-small cell lung cancer: different expression profiles in squamous cell carcinomas and adenocarcinomas.
19184060 2009 Expression of tight and adherens junction proteins in ulcerative colitis associated colorectal carcinoma: upregulation of claudin-1, claudin-3, claudin-4, and beta-catenin.
19180924 2008 [Expression of prostate stem cell antigen and Claudin-4 in human pancreatic carcinoma].
19142967 2009 Increased claudin-4 expression is associated with poor prognosis and high tumour grade in breast cancer.
19120888 2008 Changes in the expression of claudins in active ulcerative colitis.
19082451 2009 Claudin expression in rectal well-differentiated endocrine neoplasms (carcinoid tumors).
19035134 2008 [Expression of claudin-4 in eutopic and ectopic endometrium of women with endometriosis].
18954444 2008 Serial analysis of gene expression of lobular carcinoma in situ identifies down regulation of claudin 4 and overexpression of matrix metalloproteinase 9.
18786529 2008 Phosphorylation of claudin-4 is required for tight junction formation in a human keratinocyte cell line.
18752049 2009 Expression of tight junction protein claudin-4 in basal-like breast carcinomas.
18648369 2008 Identification of claudin-4 as a marker highly overexpressed in both primary and metastatic prostate cancer.
18550469 2008 Expression of occludin and claudins 1, 3, 4, and 7 in urothelial carcinoma of the upper urinary tract.
18477216 2008 Prognostic significance of intestinal claudins in high-risk synchronous and metachronous multiple gastric epithelial neoplasias after initial endoscopic submucosal dissection.
18384777 2009 Altered expression of claudin-3 and claudin-4 in ectopic endometrium of women with endometriosis.
18313739 2008 Claudin-3 and claudin-4 expression in serous papillary, clear-cell, and endometrioid endometrial cancer.
18283635 2008 Expression of matrix metalloproteinases MMP-2 and MMP-9 in gastric cancer and their relation to claudin-4 expression.
18251778 2008 Cdx2 transcription factor regulates claudin-3 and claudin-4 expression during intestinal differentiation of gastric carcinoma.
18036336 2008 Structure and function of claudins.
17962811 2008 Tight junctions in thyroid carcinogenesis: diverse expression of claudin-1, claudin-4, claudin-7 and occludin in thyroid neoplasms.
17709988 2007 Expression and function of vinculin in neuroendocrine tumors.
17678893 2007 Phosphorylation of claudin-4 by PKCepsilon regulates tight junction barrier function in ovarian cancer cells.
17651017 2007 Interferon-inducible Stat2 activation of JUND and CLDN4: mediators of IFN responses.
17545541 2007 Overexpression of Clostridium perfringens enterotoxin receptors claudin-3 and claudin-4 in uterine carcinosarcomas.
17459057 2007 Gastric and intestinal claudin expression at the invasive front of gastric carcinoma.
17418912 2007 Distinct claudin expression profile in histologic subtypes of lung cancer.
17359339 2007 Tight junction proteins in keratinocytes: localization and contribution to barrier function.
17326053 2007 Overexpression of claudin-3 and claudin-4 receptors in uterine serous papillary carcinoma: novel targets for a type-specific therapy using Clostridium perfringens enterotoxin (CPE).
16969486 2006 Differential expression of claudin-4 between intestinal and diffuse-type gastric cancer.
16949040 2006 Overexpression of human WNK1 increases paracellular chloride permeability and phosphorylation of claudin-4 in MDCKII cells.
16714763 2006 Crucial roles of Sp1 and epigenetic modifications in the regulation of the CLDN4 promoter in ovarian cancer cells.
16439986 2006 Claudin-4 differentiates biliary tract cancers from hepatocellular carcinomas.
16341674 2005 Transcriptome analysis of human gastric cancer.
16287068 2006 Differences in expression patterns of the tight junction proteins,claudin 1, 3, 4 and 5, in human ovarian surface epithelium as compared to epithelia in inclusion cysts and epithelial ovarian tumours.
16253248 2005 Claudins upregulation in human colorectal cancer.
16236711 2005 EphA2 phosphorylates the cytoplasmic tail of Claudin-4 and mediates paracellular permeability.
15862967 2005 Yeast two-hybrid identification of prostatic proteins interacting with human sex hormone-binding globulin.
15743508 2005 Claudin-1, -3 and -4 proteins and mRNA expression in benign and malignant breast lesions: a research study.
15643498 2005 Loss of the tight junction protein claudin 4 correlates with histological growth-pattern and differentiation in advanced gastric adenocarcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15366421 2004 The cytoplasmic tails of claudins can influence tight junction barrier properties through effects on protein stability.
15070779 2004 Disease-causing mutant WNK4 increases paracellular chloride permeability and phosphorylates claudins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14559813 2003 Claudin-4 expression decreases invasiveness and metastatic potential of pancreatic cancer.
12853948 2003 The DNA sequence of human chromosome 7.
12736707 2003 CLDN23 gene, frequently down-regulated in intestinal-type gastric cancer, is a novel member of CLAUDIN gene family.
12700140 2003 Claudin extracellular domains determine paracellular charge selectivity and resistance but not tight junction fibril architecture.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475568 2003 Tight junction proteins.
12231346 2002 Claudin-based barrier in simple and stratified cellular sheets.
11283726 2001 Multifunctional strands in tight junctions.
11247307 2001 The roles of claudin superfamily proteins in paracellular transport.
10690502 2000 Tight junctions of the blood-brain barrier.
10601346 1999 Direct binding of three tight junction-associated MAGUKs, ZO-1, ZO-2, and ZO-3, with the COOH termini of claudins.
9892664 1999 Claudin multigene family encoding four-transmembrane domain protein components of tight junction strands.
9878248 1998 Genes for the CPE receptor (CPETR1) and the human homolog of RVP1 (CPETR2) are localized within the Williams-Beuren syndrome deletion.
9334247 1997 Clostridium perfringens enterotoxin utilizes two structurally related membrane proteins as functional receptors in vivo.
9087440 1997 Molecular cloning and functional characterization of the receptor for Clostridium perfringens enterotoxin.