Property Summary

NCBI Gene PubMed Count 82
PubMed Score 205.46
PubTator Score 109.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Barrett's esophagus 1.100 4.1e-02
esophageal adenocarcinoma 1.500 3.3e-02
atypical teratoid / rhabdoid tumor 2.000 2.9e-02
intraductal papillary-mucinous adenoma (... -1.100 9.2e-03
active Crohn's disease -1.269 3.4e-02
lung adenocarcinoma 1.800 1.2e-03
nasopharyngeal carcinoma -1.300 2.4e-03
ductal carcinoma in situ 2.100 3.0e-02
invasive ductal carcinoma 4.000 2.6e-03
ovarian cancer 3.100 3.5e-08
pituitary cancer -1.300 6.5e-03
psoriasis -1.700 9.0e-23

Gene RIF (64)

PMID Text
26340953 localization of Cldn3, Cldn7 and Cldn10 proteins in the different compartments of murine endometrium up to day 8.5 of pregnancy (dpc) as well as in human endometrium and first trimester decidua
26148935 Cln-3 plays a vital role in TNF-modulated paracellular permeability in submandibular epithelium.
25849148 Data from live-cell imaging suggest at least two different cis-interaction interfaces within CLDN3 homopolymers as well as within CLDN1/CLDN3 heteropolymers.
25820701 Univariate analyses indicated that the T stage, lymph node metastasis, the TNM stage, and the expression of claudin-3, beta-catenin, and vimentin were significant predictors for overall survival (OS).
25755790 increased claudin-3 and claudin-4 expression may play a postive role in the progression and metastasis of gastric cancer
25744656 Further in vitro studies suggested that the isolated MAbs possessed the desired binding properties for the detection or targeting of CLDN3.
25319490 The expressions of MARVELD2, CLDN1 and CLDN3 mRNA were significantly lower in cholesteatoma tissue and may be involved in epithelium permeability.
25277196 our findings demonstrated that CLDN3 is an epigenetically silenced metastasis suppressor gene in Hepatocellular carcinoma
24974365 that Claudin-3 expression was restricted to the apical pole of ependymocytes in the subcommissural organ
24840331 The exposure to HIV-1 or HIV-1 gp120 results in a significant downregulation of tight junction proteins ZO-1, Occludin, Claudin-1, Claudin-2, Claudin-3, Claudin-4, and Claudin-5 in human retinal pigment epithelial cells
24478310 folding and assembly of CLDN3 and CLDN5 into the tight junction are controlled by non-conserved residues in the transmembrane 3 and extracellular loop 2 segments
24356983 Study highlights a profound role for the choroid plexus in the pathogenesis of multiple sclerosis, and implies that CLDN3 may be regarded as a crucial and novel determinant of blood-cerebrospinal fluid barrier integrity
24290871 Claudin 3 was expressed in all non-goblet columnar lined oesophagus, Barrett's oesophagus, high grade dysplasia and adenocarcinoma.
24073800 The degradation of claudin-3 and claudin-4 induced by acidic stress could be attenuated by specific TRPV1 blockers.
24069372 Claudin-3 overexpression increases the malignant potential of colorectal cancer cells.
23909989 Claudin-3 expression in uterine luminal epithelium is stimulated by progesterone and suppressed by heparin-binding epidermal growth factor-like growth factor.
23685873 Studies suggest that claudin-3 and claudin-4 might be targets for the treatment of chemotherapy-resistant ovarian cancer and other tumors overexpressing claudin-3 and -4 using Clostridium perfringens enterotoxin (CPE)-based theranostic agents.
23529315 Our comparative analysis of CLDN3 profile in breast and ovarian cancer clearly indicates organ specificity.
23097631 High CLDN3 expression is associated with tumor growth and metastases.
23075682 Snail and Claudin-3 may play important roles in invasion and metastasis in NSCLC
23053666 Claudin-3(CLDN3) and claudin-4 (CLDN4) affect sensitivity of the ovarian cancer cells to the cytotoxic effect of cisplatin by regulating expression of the Cu transporter CTR1.
22290341 Dow-regulation of Claudin-3 is associated with the progression of early gastric adenocarcinomas.
22128179 Mechanism of Clostridium perfringens enterotoxin interaction with claudin-3/-4 protein suggests structural modifications of the toxin to target specific claudins
21519794 CLDN3 may have a role in ovarian cancer, and its inhibition by short hairpin RNA could be a treatment strategy.
21184237 Analysis of staining intensities of CLDN 1 and 3 is useful as an auxiliary diagnostic and prognostic tool in patients with salivary gland mucoepidermoid carcinoma.
20655293 demonstrate that claudin-3 alters the tight junction meshwork and seals the paracellular pathway against the passage of small ions of either charge and uncharged solutes
20478039 Claudin-1, -3, -4, -5, and -7 are expressed in developing human lung from week 12 to week 40 with distinct locations and in divergent quantities.
20466674 no mutations in CLDN3, CLDN4 and TRPV6 were found in Idiopathic infantile hypercalcaemia patients.
20204275 Claudin-3 expression in Epstein-Barr virus-associated nasopharyngeal carcinoma was variable
20143085 Increased expressions of CLDN 2 and 3 suggest structural changes of tight junction in coeliac disease which may be, at least in part, responsible for increased permeability and proliferation observed in coeliac disease.
20053926 there was no dramatic qualititative difference in the BCC or RMS tumors associated with the mutant Blm genotype
19525861 Here we show for the first time in both an experimental and clinical setting a strong relation between intestinal tight junction loss and urinary claudin-3 levels
19460752 Knockdown of claudin 3 (CLDN3) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19429681 analysis of the interaction between Clostridium perfringens enterotoxin fragments and claudin-3
19231096 claudin-3 did not serve as a prognostic marker in lung cancer
19208807 treatment of mice with nonimmunostimulatory 2'-OMe modified CLDN3 siRNA was as effective in suppressing tumor growth as unmodifed siRNA
19184060 Tight junction proteins claudin-1, claudin-3, claudin-4, and the adherens junction protein beta-catenin are overexpressed in colorectal carcinoma.
19137073 Using a panel of four genes (AHRR, p16INK4a, MT1G, and CLDN3) resulted in sensitivity and specificity of 50% and 68%, respectively and may have utility for early detection of esophageal squamous dysplasia and early ESCC.
19082451 The expression of claudins-2, -3 and -4 in 16 rectal well-differentiated endocrine neoplasms was studied
18817843 For the first time this study proves the presence of Claudin-1, Claudin-3 and Claudin-5 in ECV304 (obtained from ECACC) cell layers and the inducibility of their expression by glioma-conditioned media.
18774778 This is the first study to demonstrate that claudin-3 is involved in the barrier function of gastric epithelial cells and that rebamipide abolishes the H2O2-induced decrease in claudin-3 protein.
18550469 claudins 1 and 3 had a significant effect on overall survival in patients with urothelial carcinoma of the upper urinary tract.
18538010 The exposure to HIV-1 or HIV-1 gp120 results in a significant downregulation of tight junction proteins ZO-1, Occludin, Claudin-1, Claudin-2, Claudin-3, Claudin-4, and Claudin-5 in human retinal pigment epithelial cells
18477216 Early gastric carcinomas demonstrating I-CLDN(+) phenotype have a high risk of synchronous and metachronous secondary gastric epithelial neoplasias.
18439941 Claudin-3 and claudin-7 expression in effusions independently predicts poor survival in ovarian cancer.
18384777 Down-regulated expression of claudin-3 and claudin-4 in ectopic endometrium suggests that claudin-3 and claudin-4 might play a pathogenic role in the formation of endometriosis.
18329007 The exposure to HIV-1 or HIV-1 gp120 results in a significant downregulation of tight junction proteins ZO-1, Occludin, Claudin-1, Claudin-2, Claudin-3, Claudin-4, and Claudin-5 in human retinal pigment epithelial cells
18313739 Increased expression of claudin-3 and claudin-4 may contribute to aggressive phenotype of endometrial cancer of serous papillary or clear-cell histology. Possible targets for therapeutic intervention.
18251778 Cdx2 plays an important role in the regulation of intestinal claudin expression not only in gastric mucosa with intestinal metaplasia but also gastric carcinoma.
17986852 siRNA-mediated knockdown of Sp1 led to a significant decrease of CLDN3 expression at both the mRNA and protein levels, demonstrating a crucial role for this transcription factor in the regulation of CLDN3.
17647191 CLDN3 overexpression can be used as a prognostic indicator in ovarian serous carcinomas and it may be a promising target for antibody-based therapy of ovarian carcinomas.
17545541 Claudin-3 and claudin-4 receptors are highly overexpressed in carcinosarcoma
17459057 Loss of claudin expression may enhance the grade of malignancy of gastric cancer in vivo.
17418912 When compared, small-cell-lung cancers, carcinoid tumors, and adenocarcinomas revealed significant differences re: CLDN3 expression.
17326053 Overexpression of claudin-3 is associated with uterine serous papillary carcinoma
17103306 Claudin tight junction proteins in endoscopy biopsy samples showed Barrett's metaplasia contains more claudin-2 and claudin-3 than found in normal esophageal mucosa, but markedly lower claudins 1 and 5, indicating very different tight junction barriers.
16627685 The gene expression profile of hepatic stem cells throughout life consists of high levels of expression of claudin-3 (CLDN-3).
16287068 claudin 3 and claudin 4 may play a role in transformation of ovarian surface epithelium towards the malignant phenotype
16253248 The expression of claudin-1, -3 and -4 was upregulated 5.7-, 1.5- and 2.4-fold, respectively, in colorectal tumor tissues in comparison to the normal ones.
15905176 claudin-3 phosphorylation by PKA may provide a mechanism for the disruption of tight junctions in ovarian cancer
15743508 in breast tissue, CLDN3 expression is similar in tumours and surrounding normal tissue, as demonstrated by immunohistochemistry and real-time PCR
15240533 up-regulation of DDR1, CLDN3, and epithelial cell adhesion molecule are early events in the development of epithelial ovarian cancer
12909588 Airway tight junctions are regulated by claudin interactions that confer the selectivity of the junction.
12736707 CLDN3, clustered with CLDN4 at human chromosome 7q11, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.

AA Sequence

MSMGLEITGTALAVLGWLGTIVCCALPMWRVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDSLL      1 - 70
ALPQDLQAARALIVVAILLAAFGLLVALVGAQCTNCVQDDTAKAKITIVAGVLFLLAALLTLVPVSWSAN     71 - 140
TIIRDFYNPVVPEAQKREMGAGLYVGWAAAALQLLGGALLCCSCPPREKKYTATKVVYSAPRSTGPGASL    141 - 210
GTGYDRKDYV                                                                211 - 220
//

Text Mined References (83)

PMID Year Title
26340953 2015 Claudin-3, claudin-7, and claudin-10 show different distribution patterns during decidualization and trophoblast invasion in mouse and human.
26148935 2015 Claudin-3 is required for modulation of paracellular permeability by TNF-? through ERK1/2/slug signaling axis in submandibular gland.
25849148 2015 Probing the cis-arrangement of prototype tight junction proteins claudin-1 and claudin-3.
25820701 2015 Decreased expression of claudin-3 is associated with a poor prognosis and EMT in completely resected squamous cell lung carcinoma.
25755790 2015 The expression patterns of tight junction protein claudin-1, -3, and -4 in human gastric neoplasms and adjacent non-neoplastic tissues.
25744656 2015 Generation of specific monoclonal antibodies against the extracellular loops of human claudin-3 by immunizing mice with target-expressing cells.
25319490 2015 Increased permeability of the epithelium of middle ear cholesteatoma.
25277196 2014 CLDN3 inhibits cancer aggressiveness via Wnt-EMT signaling and is a potential prognostic biomarker for hepatocellular carcinoma.
24974365 Anatomical, molecular and pathological consideration of the circumventricular organs.
24478310 2014 Claudin-3 and claudin-5 protein folding and assembly into the tight junction are controlled by non-conserved residues in the transmembrane 3 (TM3) and extracellular loop 2 (ECL2) segments.
24356983 2014 Disturbed function of the blood-cerebrospinal fluid barrier aggravates neuro-inflammation.
24290871 2014 Immunohistochemical analysis of metaplastic non-goblet columnar lined oesophagus shows phenotypic similarities to Barrett's oesophagus: a study in an Asian population.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24073800 2013 The degradation of airway tight junction protein under acidic conditions is probably mediated by transient receptor potential vanilloid 1 receptor.
24069372 2013 Claudin-3 overexpression increases the malignant potential of colorectal cancer cells: roles of ERK1/2 and PI3K-Akt as modulators of EGFR signaling.
23909989 2013 Progesterone and heparin-binding epidermal growth factor-like growth factor regulate the expression of tight junction protein Claudin-3 during early pregnancy.
23685873 2013 Claudins overexpression in ovarian cancer: potential targets for Clostridium Perfringens Enterotoxin (CPE) based diagnosis and therapy.
23529315 2013 CLDN3 expression and significance - breast carcinoma versus ovarian carcinoma.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23097631 2012 Tight junction proteins claudin-3 and claudin-4 control tumor growth and metastases.
23075682 2012 [Expression and significance of Snail and Claudin-3 in non-small cell lung cancer].
23053666 2013 Claudin-3 and claudin-4 regulate sensitivity to cisplatin by controlling expression of the copper and cisplatin influx transporter CTR1.
22290341 2012 Down-regulation of claudin-3 is associated with proliferative potential in early gastric cancers.
22128179 2012 Mechanism of Clostridium perfringens enterotoxin interaction with claudin-3/-4 protein suggests structural modifications of the toxin to target specific claudins.
21519794 2011 Efficient inhibition of ovarian cancer by short hairpin RNA targeting claudin-3.
21184237 2011 Expression pattern of claudins 1 and 3-an auxiliary tool in predicting behavior of mucoepidermoid carcinoma of salivary gland origin.
20655293 2010 Claudin-3 acts as a sealing component of the tight junction for ions of either charge and uncharged solutes.
20478039 2010 Divergent expression of claudin -1, -3, -4, -5 and -7 in developing human lung.
20466674 2010 Involvement of claudin 3 and claudin 4 in idiopathic infantile hypercalcaemia: a novel hypothesis?
20204275 2010 Claudin expression profiles in Epstein-Barr virus-associated nasopharyngeal carcinoma.
20143085 2010 Mucosal expression of claudins 2, 3 and 4 in proximal and distal part of duodenum in children with coeliac disease.
20053926 2010 Derepression of CLDN3 and CLDN4 during ovarian tumorigenesis is associated with loss of repressive histone modifications.
19924644 2010 Claudins in human cancer: a review.
19706201 2009 The claudins.
19525861 2010 Urine-based detection of intestinal tight junction loss.
19429681 2009 Molecular determinants of the interaction between Clostridium perfringens enterotoxin fragments and claudin-3.
19231096 2009 Diagnostic utility of expression of claudins in non-small cell lung cancer: different expression profiles in squamous cell carcinomas and adenocarcinomas.
19208807 2009 Claudin-3 gene silencing with siRNA suppresses ovarian tumor growth and metastasis.
19184060 2009 Expression of tight and adherens junction proteins in ulcerative colitis associated colorectal carcinoma: upregulation of claudin-1, claudin-3, claudin-4, and beta-catenin.
19137073 2008 Promoter methylation in cytology specimens as an early detection marker for esophageal squamous dysplasia and early esophageal squamous cell carcinoma.
19082451 2009 Claudin expression in rectal well-differentiated endocrine neoplasms (carcinoid tumors).
18817843 2008 Expression of Claudin-1, Claudin-3 and Claudin-5 in human blood-brain barrier mimicking cell line ECV304 is inducible by glioma-conditioned media.
18774778 2008 Oxidative stress induces gastric epithelial permeability through claudin-3.
18550469 2008 Expression of occludin and claudins 1, 3, 4, and 7 in urothelial carcinoma of the upper urinary tract.
18477216 2008 Prognostic significance of intestinal claudins in high-risk synchronous and metachronous multiple gastric epithelial neoplasias after initial endoscopic submucosal dissection.
18439941 2008 Claudin upregulation in ovarian carcinoma effusions is associated with poor survival.
18384777 2009 Altered expression of claudin-3 and claudin-4 in ectopic endometrium of women with endometriosis.
18313739 2008 Claudin-3 and claudin-4 expression in serous papillary, clear-cell, and endometrioid endometrial cancer.
18251778 2008 Cdx2 transcription factor regulates claudin-3 and claudin-4 expression during intestinal differentiation of gastric carcinoma.
18036336 2008 Structure and function of claudins.
17986852 2007 Regulation of the CLDN3 gene in ovarian cancer cells.
17647191 2007 Expression profile of tight junction protein claudin 3 and claudin 4 in ovarian serous adenocarcinoma with prognostic correlation.
17545541 2007 Overexpression of Clostridium perfringens enterotoxin receptors claudin-3 and claudin-4 in uterine carcinosarcomas.
17459057 2007 Gastric and intestinal claudin expression at the invasive front of gastric carcinoma.
17418912 2007 Distinct claudin expression profile in histologic subtypes of lung cancer.
17326053 2007 Overexpression of claudin-3 and claudin-4 receptors in uterine serous papillary carcinoma: novel targets for a type-specific therapy using Clostridium perfringens enterotoxin (CPE).
17103306 2006 Transepithelial leak in Barrett's esophagus.
16627685 2006 The phenotypes of pluripotent human hepatic progenitors.
16341674 2005 Transcriptome analysis of human gastric cancer.
16287068 2006 Differences in expression patterns of the tight junction proteins,claudin 1, 3, 4 and 5, in human ovarian surface epithelium as compared to epithelia in inclusion cysts and epithelial ovarian tumours.
16253248 2005 Claudins upregulation in human colorectal cancer.
15905176 2005 Phosphorylation of claudin-3 at threonine 192 by cAMP-dependent protein kinase regulates tight junction barrier function in ovarian cancer cells.
15743508 2005 Claudin-1, -3 and -4 proteins and mRNA expression in benign and malignant breast lesions: a research study.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15240533 2004 Overexpression of the cell adhesion molecules DDR1, Claudin 3, and Ep-CAM in metaplastic ovarian epithelium and ovarian cancer.
15174142 2004 Modulation of gene expression by hypoxia in human umbilical cord vein endothelial cells: A transcriptomic and proteomic study.
15070779 2004 Disease-causing mutant WNK4 increases paracellular chloride permeability and phosphorylates claudins.
12909588 2003 Role of claudin interactions in airway tight junctional permeability.
12853948 2003 The DNA sequence of human chromosome 7.
12736707 2003 CLDN23 gene, frequently down-regulated in intestinal-type gastric cancer, is a novel member of CLAUDIN gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475568 2003 Tight junction proteins.
12231346 2002 Claudin-based barrier in simple and stratified cellular sheets.
11691807 2001 Expression of Clostridium perfringens enterotoxin receptors claudin-3 and claudin-4 in prostate cancer epithelium.
11382769 2001 Claudin promotes activation of pro-matrix metalloproteinase-2 mediated by membrane-type matrix metalloproteinases.
11283726 2001 Multifunctional strands in tight junctions.
11247307 2001 The roles of claudin superfamily proteins in paracellular transport.
10690502 2000 Tight junctions of the blood-brain barrier.
10601346 1999 Direct binding of three tight junction-associated MAGUKs, ZO-1, ZO-2, and ZO-3, with the COOH termini of claudins.
10562289 1999 Manner of interaction of heterogeneous claudin species within and between tight junction strands.
9892664 1999 Claudin multigene family encoding four-transmembrane domain protein components of tight junction strands.
9441748 1997 Analysis of a human gene homologous to rat ventral prostate.1 protein.
9334247 1997 Clostridium perfringens enterotoxin utilizes two structurally related membrane proteins as functional receptors in vivo.