Property Summary

NCBI Gene PubMed Count 18
PubMed Score 14.81
PubTator Score 7.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8491 3.7e-29
psoriasis 6685 3.7e-04
medulloblastoma 1524 3.4e-03
active Crohn's disease 918 4.2e-03
Disease Target Count Z-score Confidence
Heart conduction disease 65 0.0 1.0
Disease Target Count Z-score Confidence
Pellagra 25 4.285 2.1

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.300 3.7e-04
medulloblastoma 1.100 3.4e-03
active Crohn's disease -1.746 4.2e-03
ovarian cancer -4.100 3.7e-29

AA Sequence

MSMAVETFGFFMATVGLLMLGVTLPNSYWRVSTVHGNVITTNTIFENLWFSCATDSLGVYNCWEFPSMLA      1 - 70
LSGYIQACRALMITAILLGFLGLLLGIAGLRCTNIGGLELSRKAKLAATAGALHILAGICGMVAISWYAF     71 - 140
NITRDFFDPLYPGTKYELGPALYLGWSASLISILGGLCLCSACCCGSDEDPAASARRPYQAPVSVMPVAT    141 - 210
SDQEGDSSFGKYGRNAYV                                                        211 - 228
//

Text Mined References (19)

PMID Year Title
23166209 2012 Impact of ancestry and common genetic variants on QT interval in African Americans.
19706201 2009 The claudins.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19673046 2009 Ion transport and barrier function in a telomerase-immortalized human nondysplastic, Barrett's cell line (BAR-T).
19420749 2009 Effect of claudin expression on paracellular permeability, migration and invasion of colonic cancer cells.
18036336 2008 Structure and function of claudins.
16798613 Claudins--key pieces in the tight junction puzzle.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
13129853 2003 Reversal of charge selectivity in cation or anion-selective epithelial lines by expression of different claudins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475568 2003 Tight junction proteins.
12231346 2002 Claudin-based barrier in simple and stratified cellular sheets.
12055082 2002 Claudins create charge-selective channels in the paracellular pathway between epithelial cells.
11912246 2002 Differential expression patterns of claudins, tight junction membrane proteins, in mouse nephron segments.
11283726 2001 Multifunctional strands in tight junctions.
11247307 2001 The roles of claudin superfamily proteins in paracellular transport.
11095601 2000 Corneal epithelial tight junctions and their response to lipopolysaccharide challenge.
10690502 2000 Tight junctions of the blood-brain barrier.