Property Summary

NCBI Gene PubMed Count 35
PubMed Score 320.33
PubTator Score 99.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
malignant mesothelioma 2.100 2.3e-07
ependymoma -2.900 3.1e-02
astrocytoma -1.100 3.1e-04
glioblastoma -1.900 4.1e-02
oligodendroglioma -1.600 3.4e-05
osteosarcoma 1.331 4.1e-06
group 3 medulloblastoma -2.700 2.3e-02
atypical teratoid/rhabdoid tumor -3.300 1.7e-05
primitive neuroectodermal tumor -2.600 2.0e-02
Atopic dermatitis -1.700 1.3e-02
adrenocortical carcinoma -1.847 2.2e-05
primary pancreatic ductal adenocarcinoma 2.276 2.0e-04
non-small cell lung cancer -1.644 2.8e-11
intraductal papillary-mucinous carcinoma... -1.200 2.2e-02
cystic fibrosis 1.100 3.9e-02
pediatric high grade glioma -2.000 1.0e-02
subependymal giant cell astrocytoma -4.952 8.2e-03
invasive ductal carcinoma -3.500 1.9e-03
breast carcinoma -2.700 5.3e-37
Breast cancer -4.400 1.3e-37
ovarian cancer -4.500 1.0e-10
pituitary cancer -2.300 7.9e-06
pancreatic cancer 2.200 9.8e-04

Gene RIF (14)

PMID Text
26134929 the expression of miR-99b was inversely correlated with CLDN11 levels . These findings suggest that a high level of miR-99b expression is an independent prognostic factor and correlates with poor survival of patients with Hepatocellular carcinoma (HCC)
24999589 CLDN11 is an epigenetic biomarker for malignancy in dysplastic nevus and melanoma.
24268521 these data suggest that cancer cells may induce CLDN11 overexpression and subsequent collective migration of peritumoral CAFs via TGF-beta secretion.
23919729 The expression of claudin-11 was up regulated in gastric cancer tissue.
23706332 The spatial organization of claudin-11 and connexin-43 is altered in men with primary seminiferous tubule failure.
22951003 disorganization of claudin-11 expression in Sertoli cells might be one of the factors involved in the impairment of spermatogenesis.
22736761 Treatment with 3-deazaneplanocin A, an inhibitor of H3K27 methyltransferase, attenuated CLDN11 induction by serum stimulation in parallel with sustained miR-1275 expression
21468549 claudin-11 may have a role in preventing cancer progression and may serve as a therapeutic target in reducing metastasis
20850723 late spermatogenic wave may negatively regulate claudin-11 gene activation and the subcellular localization of claudin-11 in Sertoli cells, thus altering the blood testis barrier in the human testis
20546350 Claudins 11,expression in meningiomas.
19956721 hypermethylation of CLDN11, leading to downregulated expression, contributes to gastric carcinogenesis by increasing cellular motility and invasiveness
19622796 Contribution of the tight junction protein CLDN11 to barrier function in endothelial cells is novel and may reflect hemodynamic requirements of the corpus cavernosum.
19241088 the disruption of the blood-testis barrier is related to a dysfunction of claudin-11 and not to a failure of its expression.
18412169 Data demonstrate that in rhesus monkeys immune responses directed at human OSP are encephalitogenic, leading to inflammatory responses throughout the central nervous system and to selective demyelination of the optic nerve.

AA Sequence

MVATCLQVVGFVTSFVGWIGVIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMATGLYHCKPLVD      1 - 70
ILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGQEPGVAKYRRAQLAGVLLILLALCALVATIW     71 - 140
FPVCAHRETTIVSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTHAKSAHV       141 - 207
//

Text Mined References (36)

PMID Year Title
26134929 2015 miR-99b promotes metastasis of hepatocellular carcinoma through inhibition of claudin 11 expression and may serve as a prognostic marker.
24999589 2014 Promoter CpG island hypermethylation in dysplastic nevus and melanoma: CLDN11 as an epigenetic biomarker for malignancy.
24268521 2014 Collective migration of cancer-associated fibroblasts is enhanced by overexpression of tight junction-associated proteins claudin-11 and occludin.
23919729 2013 The distinct expression patterns of claudin-2, -6, and -11 between human gastric neoplasms and adjacent non-neoplastic tissues.
23706332 2013 Claudin-11 and connexin-43 display altered spatial patterns of organization in men with primary seminiferous tubule failure compared with controls.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22951003 2012 Expression pattern of testicular claudin-11 in infertile men.
22736761 2012 Contribution of microRNA-1275 to Claudin11 protein suppression via a polycomb-mediated silencing mechanism in human glioma stem-like cells.
21743467 2011 Seven prostate cancer susceptibility loci identified by a multi-stage genome-wide association study.
21468549 2011 Claudin-11 decreases the invasiveness of bladder cancer cells.
20850723 2011 Claudin-11 expression increased in spermatogenic defect in human testes.
20546350 2010 Claudins 1, 11 and twist in meningiomas.
19956721 2009 Silencing of claudin-11 is associated with increased invasiveness of gastric cancer cells.
19706201 2009 The claudins.
19622796 2009 Transcriptional profiling of human cavernosal endothelial cells reveals distinctive cell adhesion phenotype and role for claudin 11 in vascular barrier function.
19241088 2009 Claudin-11 is over-expressed and dislocated from the blood-testis barrier in Sertoli cells associated with testicular intraepithelial neoplasia in men.
18412169 2008 Oligodendrocyte-specific protein is encephalitogenic in rhesus macaques and induces specific demyelination of the optic nerve.
18036336 2008 Structure and function of claudins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12730962 2003 Expression of complement messenger RNAs and proteins by human oligodendroglial cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475568 2003 Tight junction proteins.
12231346 2002 Claudin-based barrier in simple and stratified cellular sheets.
11591653 2001 Protein-protein interaction panel using mouse full-length cDNAs.
11309411 2001 OSP/claudin-11 forms a complex with a novel member of the tetraspanin super family and beta1 integrin and regulates proliferation and migration of oligodendrocytes.
11283726 2001 Multifunctional strands in tight junctions.
11247307 2001 The roles of claudin superfamily proteins in paracellular transport.
10797530 2000 Developmental expression of OSP/claudin-11.
10700007 2000 Involvement of OSP/claudin-11 in oligodendrocyte membrane interactions: role in biology and disease.
10690502 2000 Tight junctions of the blood-brain barrier.
10612400 1999 CNS myelin and sertoli cell tight junction strands are absent in Osp/claudin-11 null mice.
10582615 1999 A novel microtubule-associated protein-2 expressed in oligodendrocytes in multiple sclerosis lesions.
8797478 1996 Isolation and characterization of a novel oligodendrocyte-specific protein.
8661061 1996 Chromosomal localization of murine and human oligodendrocyte-specific protein genes.