Property Summary

NCBI Gene PubMed Count 27
PubMed Score 20.77
PubTator Score 18.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
nephrosclerosis -1.476 1.9e-02
astrocytic glioma -3.500 2.8e-03
ependymoma -3.200 2.6e-02
oligodendroglioma -3.000 6.7e-03
psoriasis -1.500 3.7e-04
glioblastoma -2.900 9.0e-05
osteosarcoma -1.595 1.3e-02
medulloblastoma -4.000 3.7e-10
periodontitis 1.100 2.3e-23
atypical teratoid / rhabdoid tumor -2.500 2.0e-03
medulloblastoma, large-cell -3.600 1.9e-07
primitive neuroectodermal tumor -3.800 2.1e-04
primary pancreatic ductal adenocarcinoma -1.767 7.9e-03
non-small cell lung cancer 1.962 7.4e-08
intraductal papillary-mucinous adenoma (... -3.300 1.5e-02
intraductal papillary-mucinous carcinoma... -4.300 7.8e-03
lung cancer 1.700 8.8e-03
lung adenocarcinoma 1.100 3.0e-04
pediatric high grade glioma -2.500 1.7e-05
subependymal giant cell astrocytoma -2.603 5.7e-03
nasopharyngeal carcinoma -2.700 2.3e-10
severe Alzheimer's disease -1.061 1.8e-02
Breast cancer -1.200 5.1e-04
mucosa-associated lymphoid tissue lympho... -1.347 1.1e-02
acute myeloid leukemia -1.700 1.3e-02
ovarian cancer 2.700 3.9e-05
Down syndrome 1.300 1.9e-03
pancreatic cancer -1.700 3.4e-03
head and neck cancer and chronic obstruc... -1.300 2.7e-03

Gene RIF (13)

PMID Text
26340953 localization of Cldn3, Cldn7 and Cldn10 proteins in the different compartments of murine endometrium up to day 8.5 of pregnancy (dpc) as well as in human endometrium and first trimester decidua
25867809 An algorithm combining CLDN10, HMGA2, and LAMB3 transcripts was able to discriminate tumors from BTL samples (94% sensitivity and 96% specificity in validation set).
24325792 Claudin 10 expression was down-regulated in gastric cancer.
23760508 In claudin-10b, the F66L mutant reduced cation selectivity, and the F66A mutant lost pore conductance
23591077 Expression of CLDN1 and CLDN10 was lower in invasive lepidic predominant adenocarcinoma than in lung adenocarcioma in situ. Overexpression of CLDN1 and CLDN10 indicates a favorable prognosis in some patients with lung adenocarcinoma.
23284715 The yeast two-hybrid screen identifies the HIV-1 Nef interacting human protein claudin 10 (CLDN10), which co-localizes with Nef mainly in the tight junction region and at the vesicular structures
22076167 Claudin 10/18 are most commonly expressed in lung adenocarcinomas. Female patients and non-smokers express these claudins more commonly suggesting that they may play a part in the carcinogenesis of tobacco unrelated carcinoma.
21647678 Claudin 10 protein is highly expressed in hepatocellular carcinoma (HCC) tissue and is closely related to angiogenesis. It could be a useful marker to predict poor prognosis of HCC patients after hepatectomy.
21370593 CLDN10 is a novel biomarker for detecting ovarian cancer in the chicken, a suitable animal model for investigating the effect and function of CLDN in human ovarian cancer.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19383724 Claudin-10 exists in six alternatively spliced isoforms that exhibit distinct localization and function.
18025272 These findings showed that CLDN-10 is functionally involved in hepatocellular carcinoma invasion and is a potential target for hepatocellular carcinoma therapy.
15701840 High Claudin-10 expression level is associated with recurrence of primary hepatocellular carcinoma

AA Sequence

MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLWKACVTDSTGVSNCKDFPSML      1 - 70
ALDGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDKAKAKIACLAGIVFILSGLCSMTGCSLYAN     71 - 140
KITTEFFDPLFVEQKYELGAALFIGWAGASLCIIGGVIFCFSISDNNKTPRYTYNGATSVMSSRTKYHGG    141 - 210
EDFKTTNPSKQFDKNAYV                                                        211 - 228
//

Text Mined References (28)

PMID Year Title
26340953 2015 Claudin-3, claudin-7, and claudin-10 show different distribution patterns during decidualization and trophoblast invasion in mouse and human.
25867809 2015 High Diagnostic Accuracy Based on CLDN10, HMGA2, and LAMB3 Transcripts in Papillary Thyroid Carcinoma.
24325792 2013 The distinct expression patterns of claudin-10, -14, -17 and E-cadherin between adjacent non-neoplastic tissues and gastric cancer tissues.
23760508 2013 Conserved aromatic residue confers cation selectivity in claudin-2 and claudin-10b.
23591077 2013 Expression of CLDN1 and CLDN10 in lung adenocarcinoma in situ and invasive lepidic predominant adenocarcinoma.
22076167 2011 Claudins 10 and 18 are predominantly expressed in lung adenocarcinomas and in tumors of nonsmokers.
21647678 2011 Expression of claudin 10 protein in hepatocellular carcinoma: impact on survival.
21370593 2010 Claudin 10 is a glandular epithelial marker in the chicken model as human epithelial ovarian cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19924644 2010 Claudins in human cancer: a review.
19706201 2009 The claudins.
19383724 2009 Claudin-10 exists in six alternatively spliced isoforms that exhibit distinct localization and function.
18036336 2008 Structure and function of claudins.
18025272 2007 Inhibition of hepatocellular carcinoma invasion by suppression of claudin-10 in HLE cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15701840 2005 Claudin-10 expression level is associated with recurrence of primary hepatocellular carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475568 2003 Tight junction proteins.
12231346 2002 Claudin-based barrier in simple and stratified cellular sheets.
12067061 2002 Organization and formation of the tight junction system in human epidermis and cultured keratinocytes.
11991713 2002 An evaluation of the assembly of an approximately 15-Mb region on human chromosome 13q32-q33 linked to bipolar disorder and schizophrenia.
11283726 2001 Multifunctional strands in tight junctions.
11247307 2001 The roles of claudin superfamily proteins in paracellular transport.
10690502 2000 Tight junctions of the blood-brain barrier.
10508613 1999 Ca(2+)-independent cell-adhesion activity of claudins, a family of integral membrane proteins localized at tight junctions.