Property Summary

Ligand Count 1
NCBI Gene PubMed Count 28
PubMed Score 19.48
PubTator Score 17.66

Knowledge Summary

Patent (42,817)

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Congestive heart failure 113 0.0 3.0
Disease Target Count Z-score Confidence
Neuronal ceroid lipofuscinosis 28 3.525 1.8

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.200 3.2e-05
atypical teratoid / rhabdoid tumor -1.200 2.5e-05
ependymoma -1.200 1.8e-02
glioblastoma -1.100 8.6e-04
malignant mesothelioma 1.800 1.3e-07
medulloblastoma, large-cell -1.600 8.5e-06

Gene RIF (11)

AA Sequence

MAGCRGSLCCCCRWCCCCGERETRTPEELTILGETQEEEDEILPRKDYESLDYDRCINDPYLEVLETMDN      1 - 70
KKGRRYEAVKWMVVFAIGVCTGLVGLFVDFFVRLFTQLKFGVVQTSVEECSQKGCLALSLLELLGFNLTF     71 - 140
VFLASLLVLIEPVAAGSGIPEVKCYLNGVKVPGIVRLRTLLCKVLGVLFSVAGGLFVEKEGPMIHSGSVV    141 - 210
GAGLPQFQSISLRKIQFNFPYFRSDRDKRDFVSAGAAAGVAAAFGAPIGGTLFSLEEGSSFWNQGLTWKV    211 - 280
LFCSMSATFTLNFFRSGIQFGSWGSFQLPGLLNFGEFKCSDSDKKCHLWTAMDLGFFVVMGVIGGLLGAT    281 - 350
FNCLNKRLAKYRMRNVHPKPKLVRVLESLLVSLVTTVVVFVASMVLGECRQMSSSSQIGNDSFQLQVTED    351 - 420
VNSSIKTFFCPNDTYNDMATLFFNPQESAILQLFHQDGTFSPVTLALFFVLYFLLACWTYGISVPSGLFV    421 - 490
PSLLCGAAFGRLVANVLKSYIGLGHIYSGTFALIGAAAFLGGVVRMTISLTVILIESTNEITYGLPIMVT    491 - 560
LMVAKWTGDFFNKGIYDIHVGLRGVPLLEWETEVEMDKLRASDIMEPNLTYVYPHTRIQSLVSILRTTVH    561 - 630
HAFPVVTENRGNEKEFMKGNQLISNNIKFKKSSILTRAGEQRKRSQSMKSYPSSELRNMCDEHIASEEPA    631 - 700
EKEDLLQQMLERRYTPYPNLYPDQSPSEDWTMEERFRPLTFHGLILRSQLVTLLVRGVCYSESQSSASQP    701 - 770
RLSYAEMAEDYPRYPDIHDLDLTLLNPRMIVDVTPYMNPSPFTVSPNTHVSQVFNLFRTMGLRHLPVVNA    771 - 840
VGEIVGIITRHNLTYEFLQARLRQHYQTI                                             841 - 869
//

Text Mined References (29)

PMID Year Title