Property Summary

NCBI Gene PubMed Count 19
PubMed Score 23.23
PubTator Score 26.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Crisponi syndrome 2 0.0 0.0
Disease Target Count P-value
malignant mesothelioma 3232 3.9e-06
non diabetic and post-ischemic heart failure 200 1.2e-02
Disease Target Count Z-score Confidence
cold-induced sweating syndrome 7 6.474 3.2
Disease Target Count Z-score Confidence
Focal segmental glomerulosclerosis 10 3.876 1.9
Scoliosis 44 3.376 1.7
Disease Target Count
COLD-INDUCED SWEATING SYNDROME 2 1

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma -1.100 3.9e-06
non diabetic and post-ischemic heart fai... -1.100 1.2e-02

Gene RIF (6)

AA Sequence

MDLRAGDSWGMLACLCTVLWHLPAVPALNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFN      1 - 70
EPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSL     71 - 140
QGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLKKKMQ    141 - 210
PPAAAVTLHLGAHGF                                                           211 - 225
//

Text Mined References (20)

PMID Year Title