Property Summary

NCBI Gene PubMed Count 28
PubMed Score 90.35
PubTator Score 30.54

Knowledge Summary

Patent (15,807)

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -3.300 1.0e-07
esophageal adenocarcinoma -3.800 2.5e-02
psoriasis 2.400 1.6e-04
cutaneous lupus erythematosus 1.200 4.6e-02
non-small cell lung cancer 4.108 4.0e-11
active Crohn's disease 1.644 2.2e-02
cystic fibrosis 2.300 1.5e-04
non primary Sjogren syndrome sicca -1.200 2.4e-02
nasopharyngeal carcinoma -2.000 3.2e-02
ductal carcinoma in situ 3.600 5.8e-03

Gene RIF (16)

PMID Text
26930581 CLCA2 links junctional adhesion molecule EVA1, to cytosolic signaling proteins that modulate proliferation and differentiation.
25557950 Variants in CLCA2 were associated with an ileal involvement phenotype of Crohn's disease.
25548429 CLCA2 expression is higher in squamous cell carcinoma of the lung compared with adenocarcinoma.
22990203 These results strongly suggest that CLCA2 is involved in the p53 tumor suppressor network and has a significant effect on cell migration and invasion.
22431922 the reduced expression of CLCA2 was frequently observed in various kinds of cancers including prostate cancer
21909135 hCLCA2 is required for epithelial differentiation, and its loss during tumor progression contributes to metastasis.
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
19654313 hCLCA2 Is a p53-Inducible Inhibitor of Breast Cancer Cell Proliferation.
19423540 Observational study of gene-disease association. (HuGE Navigator)
18950845 Observational study of gene-disease association. (HuGE Navigator)
16873362 Mostly extracellular with only a single transmembrane segment, unlikely to form a channel.
16158324 human CLCA2 protein and mRNA expression are elevated during epithelial stratification, suggesting that this protein plays a role in the growth of multi-layered corneal epithelia during both natural development and tissue cultivation.
15707651 immunohistochemistry clearly demonstrated colocalisation between hCLCA2 and integrin beta4
12612194 Expression of hSK4 as well as hCACC-2 and hCACC-3 but not hCACC-1 was demonstrated by reverse transcriptase PCR on native nasal tissues.
10758170 HIV-1 gp120 from both CCR5- and CXCR4-tropic HIV-1 strains opens calcium-activated potassium (K(Ca)), chloride, and calcium-permeant nonselective cation channels in macrophages; these signals are mediated by CCR5 and CXCR4

AA Sequence

MTQRSIAGPICNLKFVTLLVALSSELPFLGAGVQLQDNGYNGLLIAINPQVPENQNLISNIKEMITEASF      1 - 70
YLFNATKRRVFFRNIKILIPATWKANNNSKIKQESYEKANVIVTDWYGAHGDDPYTLQYRGCGKEGKYIH     71 - 140
FTPNFLLNDNLTAGYGSRGRVFVHEWAHLRWGVFDEYNNDKPFYINGQNQIKVTRCSSDITGIFVCEKGP    141 - 210
CPQENCIISKLFKEGCTFIYNSTQNATASIMFMQSLSSVVEFCNASTHNQEAPNLQNQMCSLRSAWDVIT    211 - 280
DSADFHHSFPMNGTELPPPPTFSLVQAGDKVVCLVLDVSSKMAEADRLLQLQQAAEFYLMQIVEIHTFVG    281 - 350
IASFDSKGEIRAQLHQINSNDDRKLLVSYLPTTVSAKTDISICSGLKKGFEVVEKLNGKAYGSVMILVTS    351 - 420
GDDKLLGNCLPTVLSSGSTIHSIALGSSAAPNLEELSRLTGGLKFFVPDISNSNSMIDAFSRISSGTGDI    421 - 490
FQQHIQLESTGENVKPHHQLKNTVTVDNTVGNDTMFLVTWQASGPPEIILFDPDGRKYYTNNFITNLTFR    491 - 560
TASLWIPGTAKPGHWTYTLNNTHHSLQALKVTVTSRASNSAVPPATVEAFVERDSLHFPHPVMIYANVKQ    561 - 630
GFYPILNATVTATVEPETGDPVTLRLLDDGAGADVIKNDGIYSRYFFSFAANGRYSLKVHVNHSPSISTP    631 - 700
AHSIPGSHAMYVPGYTANGNIQMNAPRKSVGRNEEERKWGFSRVSSGGSFSVLGVPAGPHPDVFPPCKII    701 - 770
DLEAVKVEEELTLSWTAPGEDFDQGQATSYEIRMSKSLQNIQDDFNNAILVNTSKRNPQQAGIREIFTFS    771 - 840
PQISTNGPEHQPNGETHESHRIYVAIRAMDRNSLQSAVSNIAQAPLFIPPNSDPVPARDYLILKGVLTAM    841 - 910
GLIGIICLIIVVTHHTLSRKKRADKKENGTKLL                                         911 - 943
//

Text Mined References (33)

PMID Year Title
26930581 2016 CLCA2 Interactor EVA1 Is Required for Mammary Epithelial Cell Differentiation.
25557950 2015 Identification of risk loci for Crohn's disease phenotypes using a genome-wide association study.
25548429 2014 CLCA2 as a novel immunohistochemical marker for differential diagnosis of squamous cell carcinoma from adenocarcinoma of the lung.
23112050 2012 Self-cleavage of human CLCA1 protein by a novel internal metalloprotease domain controls calcium-activated chloride channel activation.
22990203 2012 CLCA2, a target of the p53 family, negatively regulates cancer cell migration and invasion.
22431922 2012 CLCA2 as a p53-inducible senescence mediator.
21909135 2012 Loss of breast epithelial marker hCLCA2 promotes epithelial-to-mesenchymal transition and indicates higher risk of metastasis.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
19654313 2009 hCLCA2 Is a p53-Inducible Inhibitor of Breast Cancer Cell Proliferation.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16873362 2006 The putative chloride channel hCLCA2 has a single C-terminal transmembrane segment.
16158324 2006 Gene expression and immunolocalisation of a calcium-activated chloride channel during the stratification of cultivated and developing corneal epithelium.
15707651 2005 The quantification of hCLCA2 and colocalisation with integrin beta4 in stratified human epithelia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14966209 2004 Calcium-activated chloride channel-2 in human epithelia.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14512419 2003 The interacting binding domains of the beta(4) integrin and calcium-activated chloride channels (CLCAs) in metastasis.
12612194 2003 Modulation of Ca2+-activated Cl- secretion by basolateral K+ channels in human normal and cystic fibrosis airway epithelia.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12110680 2002 Focal adhesion kinase activated by beta(4) integrin ligation to mCLCA1 mediates early metastatic growth.
11445004 2001 Expression of the Ca2+-activated chloride channel genes CLCA1 and CLCA2 is downregulated in human colorectal cancer.
11320086 2001 The breast cancer beta 4 integrin and endothelial human CLCA2 mediate lung metastasis.
11262615 2000 Isolation and characterization of a Ca(2+)-activated chloride channel from human corneal epithelium.
11149902 2001 Expression and biological significance of Ca2+-activated ion channels in human keratinocytes.
11071307 2000 Molecular characteristics and functional diversity of CLCA family members.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10584316 1999 Clustering of the human CLCA gene family on the short arm of chromosome 1 (1p22-31).
10554024 1999 Tumorigenicity of human breast cancer is associated with loss of the Ca2+-activated chloride channel CLCA2.
10437792 1999 Identification of three novel members of the calcium-dependent chloride channel (CaCC) family predominantly expressed in the digestive tract and trachea.
10362588 1999 Molecular cloning and transmembrane structure of hCLCA2 from human lung, trachea, and mammary gland.