Property Summary

NCBI Gene PubMed Count 32
PubMed Score 144.18
PubTator Score 19.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
facioscapulohumeral dystrophy 3.600 7.9e-08
interstitial cystitis 4.600 2.4e-03
non-small cell lung cancer -1.804 3.4e-08
osteosarcoma -6.511 2.2e-06
Rhinitis 1.300 1.2e-02
uncontrolled asthma 2.200 3.1e-03
Waldenstrons macroglobulinemia 4.268 1.9e-03

Gene RIF (13)

AA Sequence

MSLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYG      1 - 70
AWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYL     71 - 140
KR                                                                        141 - 142
//

Text Mined References (33)

PMID Year Title