1. Home
  2. Targets
  3. cell adhesion molecule
  4. Galectin-10

Tbio Galectin-10

Regulates immune responses through the recognition of cell-surface glycans. Essential for the anergy and suppressive function of CD25-positive regulatory T-cells (Treg).

Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene is a lysophospholipase expressed in eosinophils and basophils. It hydrolyzes lysophosphatidylcholine to glycerophosphocholine and a free fatty acid. This protein may possess carbohydrate or IgE-binding activities. It is both structurally and functionally related to the galectin family of beta-galactoside binding proteins. It may be associated with inflammation and some myeloid leukemias. [provided by RefSeq, Jul 2008]

 Comments

Property Summary

NCBI Gene PubMed Count 30
PubMed Score 138.28
PubTator Score 19.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Schizophrenia 503 0.0 1.0
Disease Target Count Z-score Confidence
Galactosemia 20 3.75 1.9
Eosinophilia 65 3.501 1.8
Eosinophilic pneumonia 4 3.423 1.7

Expression

  Differential Expression (7)

Disease log2 FC p
Waldenstrons macroglobulinemia 4.268 1.9e-03
Rhinitis 1.300 1.2e-02
uncontrolled asthma 2.200 3.1e-03
osteosarcoma -6.511 2.2e-06
non-small cell lung cancer -1.804 3.4e-08
interstitial cystitis 4.900 1.3e-04
facioscapulohumeral dystrophy 3.600 7.9e-08

Synonym

Accession Q05315 C5HZ13 C5HZ14 Q0VDE3 Gal-10
Symbols GAL10
Gal-10
LGALS10
LGALS10A
LPPL_HUMAN

Gene

CLC

PANTHER Protein Class (1)

PDB

1G86   1HDK   1LCL   1QKQ  

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

 UniProt Keyword (8)

 GO Function (2)

 GO Component (1)

 GO Process (5)

 Compartment GO Term (12)

 OMIM Phenotype (1)

 HCA RNA Cell Line (22)

See all...

Pathway (1)

Gene RIF (12)

PMID Text
22880030 The results support the potential for galectin-10 to be used as a surrogate biomarker of eosinophilic airway inflammation.
21716316 CLC and IFNAR1 were identified to be overall differentially expressed between early- and late-onset CRC, and are important in the development of early-onset CRC.
20858065 DK-PGD-induced CLC/Gal-10 mRNA level can serve as a potential marker for monitoring pharmacodynamic effects of blood exposure to CRTH2 modulating agents
20237496 Observational study of gene-disease association. (HuGE Navigator)
19758173 Data show that galectin-10 expression was related to the histological grade and with the number of eosinophils in the lesion.
19650845 Genetic variation in Charcot-Leyden crystal protein was found to be associated with allergic rhinitis
19650845 Observational study of gene-disease association. (HuGE Navigator)
17502455 expressed in human T lymphocytes, galectin-10 is essential for the functional properties of CD25(+) Treg cells.
17166282 Downregulated in whole blood of infants hospitalised with respiratory syncytial virus (RSV), subtype B, bronchiolitis.
16015083 The five genes, and three of the encoded proteins, were shown differentially expressed between a group of keratoconus patients and a reference group using different techniques
12714580 Changes in the expressions of galectin-10 are potentially important for myeloid cell differentiation into specific lineages.
12031912 downregulated significantly in acute myeloid leukemia patients whose white blood cell count was higher than 100 x 10(9)/L cells

AA Sequence 

MSLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYG      1 - 70
AWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYL     71 - 140
KR                                                                        141 - 142
//

Text Mined References (31)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23894747 2013 A comprehensive family-based replication study of schizophrenia genes.
22880030 2012 Galectin-10, a potential biomarker of eosinophilic airway inflammation.
21716316 2011 CLC and IFNAR1 are differentially expressed and a global immunity score is distinct between early- and late-onset colorectal cancer.
20858065 2010 The mRNA level of Charcot-Leyden crystal protein/galectin-10 is a marker for CRTH2 activation in human whole blood in vitro.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19758173 2009 Galectin-10, eosinophils, and celiac disease.
19650845 2010 CLC- a novel susceptibility gene for allergic rhinitis?
19497882 2009 A primate subfamily of galectins expressed at the maternal-fetal interface that promote immune cell death.
17502455 2007 Human CD4+CD25+ regulatory T cells: proteome analysis identifies galectin-10 as a novel marker essential for their anergy and suppressive function.
17166282 2006 Whole blood gene expression in infants with respiratory syncytial virus bronchiolitis.
16457599 2006 Comparative proteomics of nasal fluid in seasonal allergic rhinitis.
16015083 2005 Altered expression of CLC, DSG3, EMP3, S100A2, and SLPI in corneal epithelium from keratoconus patients.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12714580 2003 Potential roles of galectins in myeloid differentiation into three different lineages.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12031912 2002 Overexpression of translocation-associated fusion genes of FGFRI, MYC, NPMI, and DEK, but absence of the translocations in acute myeloid leukemia. A microarray analysis.
11834744 2002 Charcot-Leyden crystal protein (galectin-10) is not a dual function galectin with lysophospholipase activity but binds a lysophospholipase inhibitor in a novel structural fashion.
10529229 1999 Selective recognition of mannose by the human eosinophil Charcot-Leyden crystal protein (galectin-10): a crystallographic study at 1.8 A resolution.
9119387 1997 The genomic structure of the human Charcot-Leyden crystal protein gene is analogous to those of the galectin genes.
8747464 1995 Crystal structure of human Charcot-Leyden crystal protein, an eosinophil lysophospholipase, identifies it as a new member of the carbohydrate-binding family of galectins.
8419478 1993 Molecular cloning and characterization of human eosinophil Charcot-Leyden crystal protein (lysophospholipase). Similarities to IgE binding proteins and the S-type animal lectin superfamily.
8400237 1993 Human eosinophil Charcot-Leyden crystal protein: cloning and characterization of a lysophospholipase gene promoter.
6511787 1984 Biochemical characterization of human eosinophil Charcot-Leyden crystal protein (lysophospholipase).
2709814 1989 Ultrastructural localization of the Charcot-Leyden crystal protein (lysophospholipase) to granules and intragranular crystals in mature human basophils.
2160563 1990 Ultrastructural localization of Charcot-Leyden crystal protein (lysophospholipase) to intracytoplasmic crystals in tumor cells of primary solid and papillary epithelial neoplasm of the pancreas.
2160562 1990 Ultrastructural localization of Charcot-Leyden crystal protein (lysophospholipase) and peroxidase in macrophages, eosinophils, and extracellular matrix of the skin in the hypereosinophilic syndrome.
1577491 1992 Localization of the human eosinophil Charcot-Leyden crystal protein (lysophospholipase) gene (CLC) to chromosome 19 and the human ribonuclease 2 (eosinophil-derived neurotoxin) and ribonuclease 3 (eosinophil cationic protein) genes (RNS2 and RNS3) to chromosome 14.
1373430 1992 Charcot-Leyden crystal protein in the degranulation and recovery of activated basophils.
942977 1976 Comparative properties of the Charcot-Leyden crystal protein and the major basic protein from human eosinophils.