Property Summary

NCBI Gene PubMed Count 43
PubMed Score 22.41
PubTator Score 18.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adrenocortical adenoma 1.216 2.4e-02
adult high grade glioma -1.800 1.1e-04
astrocytic glioma 1.300 1.9e-02
atypical teratoid / rhabdoid tumor -2.400 1.0e-03
Breast cancer -1.400 6.4e-09
colon cancer -1.200 5.8e-03
Down syndrome 1.100 3.0e-03
ependymoma 1.100 3.4e-02
glioblastoma -1.500 2.5e-05
hereditary spastic paraplegia -1.127 7.4e-03
intraductal papillary-mucinous neoplasm ... 1.300 9.3e-03
lung cancer 1.100 8.4e-03
lung carcinoma 1.300 2.5e-26
malignant mesothelioma 1.100 5.3e-05
medulloblastoma -1.100 4.4e-03
medulloblastoma, large-cell -1.200 1.2e-02
non primary Sjogren syndrome sicca -1.100 1.6e-02
oligodendroglioma 1.600 3.5e-03
osteosarcoma 1.933 9.4e-08
ovarian cancer -1.600 1.7e-05
Pick disease -1.200 1.3e-03
pituitary cancer 1.200 4.2e-07
psoriasis -1.400 1.3e-08
subependymal giant cell astrocytoma -1.984 1.3e-02

 MGI Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (23)

AA Sequence

MAMGDDKSFDDEESVDGNRPSSAASAFKVPAPKTSGNPANSARKPGSAGGPKVGGASKEGGAGAVDEDDF      1 - 70
IKAFTDVPSIQIYSSRELEETLNKIREILSDDKHDWDQRANALKKIRSLLVAGAAQYDCFFQHLRLLDGA     71 - 140
LKLSAKDLRSQVVREACITVAHLSTVLGNKFDHGAEAIVPTLFNLVPNSAKVMATSGCAAIRFIIRHTHV    141 - 210
PRLIPLITSNCTSKSVPVRRRSFEFLDLLLQEWQTHSLERHAAVLVETIKKGIHDADAEARVEARKTYMG    211 - 280
LRNHFPGEAETLYNSLEPSYQKSLQTYLKSSGSVASLPQSDRSSSSSQESLNRPFSSKWSTANPSTVAGR    281 - 350
VSAGSSKASSLPGSLQRSRSDIDVNAAAGAKAHHAAGQSVRRGRLGAGALNAGSYASLEDTSDKLDGTAS    351 - 420
EDGRVRAKLSAPLAGMGNAKADSRGRSRTKMVSQSQPGSRSGSPGRVLTTTALSTVSSGVQRVLVNSASA    421 - 490
QKRSKIPRSQGCSREASPSRLSVARSSRIPRPSVSQGCSREASRESSRDTSPVRSFQPLASRHHSRSTGA    491 - 560
LYAPEVYGASGPGYGISQSSRLSSSVSAMRVLNTGSDVEEAVADALKKPARRRYESYGMHSDDDANSDAS    561 - 630
SACSERSYSSRNGSIPTYMRQTEDVAEVLNRCASSNWSERKEGLLGLQNLLKNQRTLSRVELKRLCEIFT    631 - 700
RMFADPHGKRVFSMFLETLVDFIQVHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRESFPN    701 - 770
DLQFNILMRFTVDQTQTPSLKVKVAILKYIETLAKQMDPGDFINSSETRLAVSRVITWTTEPKSSDVRKA    771 - 840
AQSVLISLFELNTPEFTMLLGALPKTFQDGATKLLHNHLRNTGNGTQSSMGSPLTRPTPRSPANWSSPLT    841 - 910
SPTNTSQNTLSPSAFDYDTENMNSEDIYSSLRGVTEAIQNFSFRSQEDMNEPLKRDSKKDDGDSMCGGPG    911 - 980
MSDPRAGGDATDSSQTALDNKASLLHSMPTHSSPRSRDYNPYNYSDSISPFNKSALKEAMFDDDADQFPD    981 - 1050
DLSLDHSDLVAELLKELSNHNERVEERKIALYELMKLTQEESFSVWDEHFKTILLLLLETLGDKEPTIRA   1051 - 1120
LALKVLREILRHQPARFKNYAELTVMKTLEAHKDPHKEVVRSAEEAASVLATSISPEQCIKVLCPIIQTA   1121 - 1190
DYPINLAAIKMQTKVIERVSKETLNLLLPEIMPGLIQGYDNSESSVRKACVFCLVAVHAVIGDELKPHLS   1191 - 1260
QLTGSKMKLLNLYIKRAQTGSGGADPTTDVSGQS                                       1261 - 1294
//

Text Mined References (55)

PMID Year Title