Property Summary

NCBI Gene PubMed Count 27
PubMed Score 29.14
PubTator Score 30.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (36)

Disease log2 FC p
Polycystic ovary syndrome 2.225 4.1e-03
acute myeloid leukemia -1.500 1.8e-02
astrocytoma 1.700 3.7e-10
Atopic dermatitis 2.300 8.0e-05
atypical teratoid / rhabdoid tumor 1.500 6.0e-05
Breast cancer 2.500 1.2e-25
breast carcinoma 1.800 1.4e-06
colon cancer 1.500 2.6e-05
dermatomyositis 1.300 6.8e-03
ductal carcinoma in situ 2.900 2.5e-04
Endometriosis 1.335 3.4e-02
esophageal adenocarcinoma 1.400 3.8e-02
glioblastoma 1.800 1.3e-04
group 3 medulloblastoma 2.500 1.3e-03
interstitial cystitis 1.200 4.5e-02
intraductal papillary-mucinous carcinoma... 3.100 4.9e-05
intraductal papillary-mucinous neoplasm ... 3.300 7.5e-04
invasive ductal carcinoma 3.600 4.1e-04
juvenile dermatomyositis 1.391 6.5e-09
lung cancer 2.600 2.4e-05
lung carcinoma -1.200 2.1e-10
medulloblastoma, large-cell 1.600 2.4e-05
Multiple myeloma 1.042 3.6e-02
nasopharyngeal carcinoma 1.500 2.1e-04
non-small cell lung cancer 1.198 3.1e-11
oligodendroglioma 2.000 2.2e-10
ovarian cancer 2.100 4.3e-06
pancreatic cancer 2.100 4.2e-06
pancreatic ductal adenocarcinoma liver m... 1.936 3.4e-02
pediatric high grade glioma 1.600 6.8e-03
primary Sjogren syndrome 1.700 2.0e-03
primitive neuroectodermal tumor 1.500 1.1e-04
psoriasis 1.900 6.9e-08
subependymal giant cell astrocytoma 3.057 3.7e-03
tuberculosis and treatment for 3 months -1.100 1.5e-04
Waldenstrons macroglobulinemia 1.762 3.3e-02

Synonym

Accession P33552 Q6FGI9 Q6LET5 CKS-2
Symbols CKSHS2

Gene

PANTHER Protein Class (2)

PDB

4Y72   4YC3   5HQ0   5LQF   1CKS  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (16)

AA Sequence

MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFR      1 - 70
RPLPKDQQK                                                                  71 - 79
//

Text Mined References (30)

PMID Year Title