Property Summary

NCBI Gene PubMed Count 24
PubMed Score 77.48
PubTator Score 24.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.200 2.5e-02
ependymoma -1.400 2.0e-02
oligodendroglioma -1.200 1.7e-02
psoriasis -1.600 7.3e-04
intraductal papillary-mucinous adenoma (... 1.700 3.9e-03
subependymal giant cell astrocytoma 2.272 2.5e-02
gastric carcinoma -2.900 4.2e-02
ductal carcinoma in situ -1.900 4.0e-04
invasive ductal carcinoma -2.000 3.1e-03

Protein-protein Interaction (3)

Gene RIF (4)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
17289898 CK2alpha has a role in progression of acute myeloid leukemia
16020522 After the training period, intracellular energetic units had a higher control of mitochondrial respiration by creatine linked to a more efficient functional coupling adenine nucleotide translocase-mitochondrial creatine kinase.
15044463 three C-terminal lysines determine high affinity sMtCK/cardiolipin interaction and its effects on MtCK structure, whereas low level binding and some effect on membrane fluidity depend on other structural components

AA Sequence

MASIFSKLLTGRNASLLFATMGTSVLTTGYLLNRQKVCAEVREQPRLFPPSADYPDLRKHNNCMAECLTP      1 - 70
AIYAKLRNKVTPNGYTLDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFADLFDPVIKLRHNGYDPRVMK     71 - 140
HTTDLDASKITQGQFDEHYVLSSRVRTGRSIRGLSLPPACTRAERREVENVAITALEGLKGDLAGRYYKL    141 - 210
SEMTEQDQQRLIDDHFLFDKPVSPLLTCAGMARDWPDARGIWHNYDKTFLIWINEEDHTRVISMEKGGNM    211 - 280
KRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHVRIPKLSKDPRFSKILENLR    281 - 350
LQKRGTGGVDTAAVADVYDISNIDRIGRSEVELVQIVIDGVNYLVDCEKKLERGQDIKVPPPLPQFGKK     351 - 419
//

Text Mined References (24)

PMID Year Title
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20833797 2011 Phosphoproteome analysis of functional mitochondria isolated from resting human muscle reveals extensive phosphorylation of inner membrane protein complexes and enzymes.
17289898 2007 Protein kinase CK2alpha as an unfavorable prognostic marker and novel therapeutic target in acute myeloid leukemia.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16020522 2005 Functional coupling of adenine nucleotide translocase and mitochondrial creatine kinase is enhanced after exercise training in lung transplant skeletal muscle.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15044463 2004 C-terminal lysines determine phospholipid interaction of sarcomeric mitochondrial creatine kinase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12401781 2003 Differential effects of peroxynitrite on human mitochondrial creatine kinase isoenzymes. Inactivation, octamer destabilization, and identification of involved residues.
11874479 2002 Creatine kinase and creatine transporter in normal, wounded, and diseased skin.
11768757 2000 A quantitative approach to membrane binding of human ubiquitous mitochondrial creatine kinase using surface plasmon resonance.
10893433 2000 Creatine and creatinine metabolism.
10748055 2000 Octamers of mitochondrial creatine kinase isoenzymes differ in stability and membrane binding.
10674997 2000 Characterization of two types of mitochondrial creatine kinase isolated from normal human cardiac muscle and brain tissue.
10462222 1999 Oxidative myocytes of heart and skeletal muscle express abundant sarcomeric mitochondrial creatine kinase.
9746319 1998 Molecular characterization of the creatine kinases and some historical perspectives.
9312135 1997 Elements regulating cardiomyocyte expression of the human sarcomeric mitochondrial creatine kinase gene in transgenic mice.
8276398 1993 The gene for creatine kinase, mitochondrial 2 (sarcomeric; CKMT2), maps to chromosome 5q13.3.
7808456 Expression of the mitochondrial creatine kinase genes.
2914937 1989 Isolation and characterization of the gene and cDNA encoding human mitochondrial creatine kinase.
2324105 1990 Separate nuclear genes encode sarcomere-specific and ubiquitous human mitochondrial creatine kinase isoenzymes.
1917943 1991 Regulatory element analysis and structural characterization of the human sarcomeric mitochondrial creatine kinase gene.