Property Summary

NCBI Gene PubMed Count 26
PubMed Score 78.62
PubTator Score 6.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.300 1.8e-82

Protein-protein Interaction (2)

Gene RIF (7)

PMID Text
24522192 CKMT1 is a key regulator of the permeability transition pore through a complex that is distinct from the classical permeability transition pore.
23880370 the knock-down of the mitochondrial creatine kinase-1 (CKMT1) by RNA interference causes the dissipation of the mitochondrial membrane potential
22190034 HIV-1 IN is identified to have a physical interaction with creatine kinase, mitochondrial 1A (CKMT1A) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20877624 Observational study of gene-disease association. (HuGE Navigator)
20302626 ASB9 interacts with the creatine kinase system and negatively regulates cell growth.
19415690 uMtCK in prostate neoplasm cells (LNCaP) contributes to overproduction of reactive oxygen species, activation of Akt signaling pathway and more aggressive phenotypes including androgen independence development.
17028143 MtCK, but not NDPK-D, shows some specificity in the nature of the lipids transferred and it is not active with phosphatidylcholine alone

AA Sequence

MAGPFSRLLSARPGLRLLALAGAGSLAAGFLLRPEPVRAASERRRLYPPSAEYPDLRKHNNCMASHLTPA      1 - 70
VYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKH     71 - 140
TTDLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLS    141 - 210
EMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMK    211 - 280
RVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRL    281 - 350
QKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH       351 - 417
//

Text Mined References (28)

PMID Year Title
24522192 2014 CKMT1 regulates the mitochondrial permeability transition pore in a process that provides evidence for alternative forms of the complex.
23880370 2013 Reconstitution of CKMT1 expression fails to rescue cells from mitochondrial membrane potential dissipation: implications for controlling RNAi experiments.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20302626 2010 ASB9 interacts with ubiquitous mitochondrial creatine kinase and inhibits mitochondrial function.
19415690 2009 Ubiquitous mitochondrial creatine kinase is overexpressed in the conditioned medium and the extract of LNCaP lineaged androgen independent cell lines and facilitates prostate cancer progression.
17028143 2007 Novel lipid transfer property of two mitochondrial proteins that bridge the inner and outer membranes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12401781 2003 Differential effects of peroxynitrite on human mitochondrial creatine kinase isoenzymes. Inactivation, octamer destabilization, and identification of involved residues.
11874479 2002 Creatine kinase and creatine transporter in normal, wounded, and diseased skin.
11768757 2000 A quantitative approach to membrane binding of human ubiquitous mitochondrial creatine kinase using surface plasmon resonance.
11602586 2001 Mitochondrial creatine kinase and mitochondrial outer membrane porin show a direct interaction that is modulated by calcium.
10893433 2000 Creatine and creatinine metabolism.
10748055 2000 Octamers of mitochondrial creatine kinase isoenzymes differ in stability and membrane binding.
10737943 2000 Crystal structure of human ubiquitous mitochondrial creatine kinase.
9746319 1998 Molecular characterization of the creatine kinases and some historical perspectives.
8923416 Regulation of creatine kinase isoenzymes in human placenta during early, mid-, and late gestation.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7896282 1994 The ubiquitous mitochondrial creatine kinase gene maps to a conserved region on human chromosome 15q15 and mouse chromosome 2 bands F1-F3.
7808456 Expression of the mitochondrial creatine kinase genes.
7525559 1994 In vitro complex formation between the octamer of mitochondrial creatine kinase and porin.
6584077 1983 Control of heart oxidative phosphorylation by creatine kinase in mitochondrial membranes.
3400641 1988 Human creatine kinase genes on chromosomes 15 and 19, and proximity of the gene for the muscle form to the genes for apolipoprotein C2 and excision repair.
2914937 1989 Isolation and characterization of the gene and cDNA encoding human mitochondrial creatine kinase.
2324105 1990 Separate nuclear genes encode sarcomere-specific and ubiquitous human mitochondrial creatine kinase isoenzymes.