Property Summary

NCBI Gene PubMed Count 44
PubMed Score 121.18
PubTator Score 55.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
non-small cell lung cancer 2798 1.2e-18
ovarian cancer 8491 3.0e-04
psoriasis 6685 3.4e-04
lung cancer 4473 4.0e-04
Disease Target Count Z-score Confidence
Osteoporosis 259 0.0 1.0
Disease Target Count Z-score Confidence
Sudden infant death syndrome 34 4.504 2.3

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.300 3.4e-04
non-small cell lung cancer 1.406 1.2e-18
lung cancer 1.900 4.0e-04
ovarian cancer 1.300 3.0e-04

 GWAS Trait (1)

Protein-protein Interaction (183)

SFI1   KIF2A   PLK4   NDC80   AURKA   XPO1   CEP290   NPHP1   ZW10   CCP110   BUB1   SSNA1   RAD21   BUB1B   DIAPH2   CLASP2   NPHP4   HMMR   OFD1   DCTN3   HAUS5   CEP152   CCNB2   ZWINT   PCNT   FGFR1OP   TUBB4A   CDK1   TUBB   HSP90AA1   CCNB1   PRKACA   TUBG1   CLIP1   PRKAR2B   PPP1CC   CETN2   RPS27   PAFAH1B1   RANGAP1   CSNK1D   CENPF   CSNK1E   RANBP2   KNTC1   NEK2   NUP98   PLK1   SEC13   NUP107   CDC42   RAB8A   RAB11A   DYNLL1   TUBA4A   TUBB4B   CENPE   NUP160   CDC20   MAD2L1   ITGB3BP   DYNC1I2   DCTN2   DCTN1   DYNC1H1   ESPL1   SMC1A   IQCB1   PCM1   MAPRE1   PDS5A   TCTN1   ERCC6L   C2CD3   CDCA8   SGO2   ODF2   SGO1   TMEM67   CEP78   KIF24   CEP162   CEP135   RPGRIP1L   HAUS3   CENPP   TTBK2   TCTN3   PMF1   BORA   CENPU   TUBA1A   CENPQ   TAOK1   CLASP1   HAUS6   WAPL   CNTRL   SDCCAG8   CEP57   CEP97   CENPL   AHI1   CENPS   STAG2   KIF2B   SPC24   NUP43   NUP37   KNL1   CEP70   NEDD1   KIF18A   CEP76   ALMS1   CEP192   FBF1   NUP133   SKA2   STAG1   AHCTF1   CENPI   SKA1   CENPT   HAUS1   OPTN   TUBGCP3   SPDL1   SEH1L   CDCA5   AURKB   TCTN2   CENPN   AJUBA   NSL1   MARK4   CEP63   SCLT1   RAB3IP   TUBGCP6   TUBGCP5   CDK5RAP2   CEP89   KIF2C   HAUS7   B9D2   CENPK   TUBGCP2   HAUS8   CENPO   CEP250   NUP85   HDAC8   CEP41   NUF2   NDEL1   MIS12   CENPH   HAUS4   ZWILCH   SPC25   CENPJ   INCENP   TUBG2   CENPM   PDS5B   HAUS2   MKS1   NDE1   TMEM216   CEP72   RCC2   CC2D2A   TUBGCP4   TPX2   B9D1   CEP131   CEP164   SMC3   NUDC   NINL   CEP83   MAD1L1  

Gene RIF (20)

PMID Text
26497677 Eribulin binding to the tip of microtubules and subsequent loss of ch-TOG is a priming event leading to alterations in microtubule dynamics and breast cancer cell migration.
26414402 Data show that cytoskeleton associated protein 5 (chTOG) only weakly promotes importin-regulated microtubule nucleation, but acts synergistically with microtubule- associated protein TPX2.
25013050 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that CKAP5 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with CKAP5
24968937 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that CKAP5 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with CKAP5
24273164 Aurora-A kinase does not regulate TACC3-chTOG complex formation, indicating that Aurora-A solely functions as a recruitment factor for the TACC3-chTOG complex to centrosomes and proximal mitotic spindles.
23444224 Data show that five genes CKAP5, KPNB1, RAN, TPX2 and KIF11 were shown to be essential for tumor cell survival in both head and neck squamous cell carcinoma (HNSCC)and non-small cell lung cancer (NSCLC), but most particularly in HNSCC.
23251535 These observations indicate that EB1 and ch-TOG regulate microtubule organisation differently via distinct regions in the plus ends of microtubules.
22891263 Clathrin promotes centrosome maturation by stabilizing the microtubule-binding protein ch-TOG, defining a novel role for the clathrin-ch-TOG complex.
20838383 Data show that ILK performs its centrosome clustering activity in a centrosome-dependent, manner through the microtubule regulating proteins TACC3 and ch-TOG.
20566684 the association between aurora A phosphorylation and spindle apparatus; regulation from aurora A is mediated by CHC in recruiting phospho-TACC3 and subsequently ch-TOG to mitotic spindles.
20508983 Observational study of gene-disease association. (HuGE Navigator)
20200978 Observational study of gene-disease association. (HuGE Navigator)
19996280 Data show that 4-oxo-4-HPR inhibited tubulin polymerization and modulated gene expression of spindle aberration associated genes Kif 1C, Kif 2A, Eg5, Tara, tankyrase-1, centractin, and TOGp.
19373773 Data hypothesize that TOGp is required for chromosome motility as a downstream consequence of reduced microtubule dynamics and/or density.
18809577 ch-Tog has at least two distinct roles in spindle formation: it protects kinetochore microtubules from depolymerization by MCAK, and ch-Tog plays an essential role in centrosomal microtubule assembly, a function independent of MCAK activity.
18663358 A novel function of Aurora-A, the regulation of ch-TOG and MCAK localization, in a common pathway in control of spindle pole integrity.
17376965 Hsp90 is required to localize ch-TOG to the mitotic spindle.
15703215 TOG mediates the association of hnRNP A2-positive granules with microtubules during transport and/or localization
14718566 TOG has roles during mitosis in focusing MT minus ends at spindle poles, maintaining centrosome integrity, and contributing to spindle bipolarity
11903063 Interaction of the transforming acidic coiled-coil 1 (TACC1) protein with ch-TOG and GAS41/NuBI1 suggests multiple TACC1-containing protein complexes in human cells

AA Sequence

MGDDSEWLKLPVDQKCEHKLWKARLSGYEEALKIFQKIKDEKSPEWSKFLGLIKKFVTDSNAVVQLKGLE      1 - 70
AALVYVENAHVAGKTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYIEIEKGEAVQEELLKGLDNKNPKI     71 - 140
IVACIETLRKALSEFGSKIILLKPIIKVLPKLFESREKAVRDEAKLIAVEIYRWIRDALRPPLQNINSVQ    141 - 210
LKELEEEWVKLPTSAPRPTRFLRSQQELEAKLEQQQSAGGDAEGGGDDGDEVPQIDAYELLEAVEILSKL    211 - 280
PKDFYDKIEAKKWQERKEALESVEVLIKNPKLEAGDYADLVKALKKVVGKDTNVMLVALAAKCLTGLAVG    281 - 350
LRKKFGQYAGHVVPTILEKFKEKKPQVVQALQEAIDAIFLTTTLQNISEDVLAVMDNKNPTIKQQTSLFI    351 - 420
ARSFRHCTASTLPKSLLKPFCAALLKHINDSAPEVRDAAFEALGTALKVVGEKAVNPFLADVDKLKLDKI    421 - 490
KECSEKVELIHGKKAGLAADKKEFKPLPGRTAASGAAGDKDTKDISAPKPGPLKKAPAAKAGGPPKKGKP    491 - 560
AAPGGAGNTGTKNKKGLETKEIVEPELSIEVCEEKASAVLPPTCIQLLDSSNWKERLACMEEFQKAVELM    561 - 630
DRTEMPCQALVRMLAKKPGWKETNFQVMQMKLHIVALIAQKGNFSKTSAQVVLDGLVDKIGDVKCGNNAK    631 - 700
EAMTAIAEACMLPWTAEQVVSMAFSQKNPKNQSETLNWLSNAIKEFGFSGLNVKAFISNVKTALAATNPA    701 - 770
VRTAAITLLGVMYLYVGPSLRMFFEDEKPALLSQIDAEFEKMQGQSPPAPTRGISKHSTSGTDEGEDGDE    771 - 840
PDDGSNDVVDLLPRTEISDKITSELVSKIGDKNWKIRKEGLDEVAGIINDAKFIQPNIGELPTALKGRLN    841 - 910
DSNKILVQQTLNILQQLAVAMGPNIKQHVKNLGIPIITVLGDSKNNVRAAALATVNAWAEQTGMKEWLEG    911 - 980
EDLSEELKKENPFLRQELLGWLAEKLPTLRSTPTDLILCVPHLYSCLEDRNGDVRKKAQDALPFFMMHLG    981 - 1050
YEKMAKATGKLKPTSKDQVLAMLEKAKVNMPAKPAPPTKATSKPMGGSAPAKFQPASAPAEDCISSSTEP   1051 - 1120
KPDPKKAKAPGLSSKAKSAQGKKMPSKTSLKEDEDKSGPIFIVVPNGKEQRMKDEKGLKVLKWNFTTPRD   1121 - 1190
EYIEQLKTQMSSCVAKWLQDEMFHSDFQHHNKALAVMVDHLESEKEGVIGCLDLILKWLTLRFFDTNTSV   1191 - 1260
LMKALEYLKLLFTLLSEEEYHLTENEASSFIPYLVVKVGEPKDVIRKDVRAILNRMCLVYPASKMFPFIM   1261 - 1330
EGTKSKNSKQRAECLEELGCLVESYGMNVCQPTPGKALKEIAVHIGDRDNAVRNAALNTIVTVYNVHGDQ   1331 - 1400
VFKLIGNLSEKDMSMLEERIKRSAKRPSAAPIKQVEEKPQRAQNISSNANMLRKGPAEDMSSKLNQARSM   1401 - 1470
SGHPEAAQMVRREFQLDLDEIENDNGTVRCEMPELVQHKLDDIFEPVLIPEPKIRAVSPHFDDMHSNTAS   1471 - 1540
TINFIISQVASGDINTSIQALTQIDEVLRQEDKAEAMSGHIDQFLIATFMQLRLIYNTHMADEKLEKDEI   1541 - 1610
IKLYSCIIGNMISLFQIESLAREASTGVLKDLMHGLITLMLDSRIEDLEEGQQVIRSVNLLVVKVLEKSD   1611 - 1680
QTNILSALLVLLQDSLLATASSPKFSELVMKCLWRMVRLLPDTINSINLDRILLDIHIFMKVFPKEKLKQ   1681 - 1750
CKSEFPIRTLKTLLHTLCKLKGPKILDHLTMIDNKNESELEAHLCRMMKHSMDQTGSKSDKETEKGASRI   1751 - 1820
DEKSSKAKVNDFLAEIFKKIGSKENTKEGLAELYEYKKKYSDADIEPFLKNSSQFFQSYVERGLRVIEME   1821 - 1890
REGKGRISTSTGISPQMEVTCVPTPTSTVSSIGNTNGEEVGPSVYLERLKILRQRCGLDNTKQDDRPPLT   1891 - 1960
SLLSKPAVPTVASSTDMLHSKLSQLRESREQHQHSDLDSNQTHSSGTVTSSSSTANIDDLKKRLERIKSS   1961 - 2030
RK                                                                       2031 - 2032
//

Text Mined References (57)

PMID Year Title
27156448 2016 A TOG Protein Confers Tension Sensitivity to Kinetochore-Microtubule Attachments.
26497677 2015 Eribulin targets a ch-TOG-dependent directed migration of cancer cells.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26414402 2015 Complementary activities of TPX2 and chTOG constitute an efficient importin-regulated microtubule nucleation module.
25596274 2015 TACC3-ch-TOG track the growing tips of microtubules independently of clathrin and Aurora-A phosphorylation.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24966168 2014 The XMAP215 family drives microtubule polymerization using a structurally diverse TOG array.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24273164 2014 The centrosomal adaptor TACC3 and the microtubule polymerase chTOG interact via defined C-terminal subdomains in an Aurora-A kinase-independent manner.
23532825 2013 Specific removal of TACC3-ch-TOG-clathrin at metaphase deregulates kinetochore fiber tension.
23444224 2013 Functional genetic screens identify genes essential for tumor cell survival in head and neck and lung cancer.
23251535 2012 Dissecting the nanoscale distributions and functions of microtubule-end-binding proteins EB1 and ch-TOG in interphase HeLa cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22891263 2012 Clathrin promotes centrosome integrity in early mitosis through stabilization of centrosomal ch-TOG.
21646404 2011 SLAIN2 links microtubule plus end-tracking proteins and controls microtubule growth in interphase.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21297582 2011 A TACC3/ch-TOG/clathrin complex stabilises kinetochore fibres by inter-microtubule bridging.
21269460 2011 Initial characterization of the human central proteome.
20838383 2011 A critical role of integrin-linked kinase, ch-TOG and TACC3 in centrosome clustering in cancer cells.
20694011 2010 Association of IFIH1 and other autoimmunity risk alleles with selective IgA deficiency.
20566684 2010 Clathrin heavy chain mediates TACC3 targeting to mitotic spindles to ensure spindle stability.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20360068 2010 Systematic analysis of human protein complexes identifies chromosome segregation proteins.
20200978 2010 Replication of previous genome-wide association studies of bone mineral density in premenopausal American women.
19996280 2009 Antimitotic effect of the retinoid 4-oxo-fenretinide through inhibition of tubulin polymerization: a novel mechanism of retinoid growth-inhibitory activity.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19373773 2009 TOGp regulates microtubule assembly and density during mitosis and contributes to chromosome directional instability.
19079262 2009 New sequence variants associated with bone mineral density.
18809577 2008 MCAK-independent functions of ch-Tog/XMAP215 in microtubule plus-end dynamics.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18663358 2008 Aurora-A and ch-TOG act in a common pathway in control of spindle pole integrity.
18468998 2008 Blood pressure is regulated by an alpha1D-adrenergic receptor/dystrophin signalosome.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17376965 2007 Hsp90 is required to localise cyclin B and Msps/ch-TOG to the mitotic spindle in Drosophila and humans.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16462731 2006 The PITSLRE/CDK11p58 protein kinase promotes centrosome maturation and bipolar spindle formation.
15703215 2005 The microtubule-associated protein tumor overexpressed gene binds to the RNA trafficking protein heterogeneous nuclear ribonucleoprotein A2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14718566 2004 TOGp, the human homolog of XMAP215/Dis1, is required for centrosome integrity, spindle pole organization, and bipolar spindle assembly.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14603251 2003 TACC1-chTOG-Aurora A protein complex in breast cancer.
12852856 2003 Polo-like kinase 1 regulates Nlp, a centrosome protein involved in microtubule nucleation.
12569123 2003 The ch-TOG/XMAP215 protein is essential for spindle pole organization in human somatic cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12221128 2002 Centrosomal proteins CG-NAP and kendrin provide microtubule nucleation sites by anchoring gamma-tubulin ring complex.
11903063 2002 Interaction of the transforming acidic coiled-coil 1 (TACC1) protein with ch-TOG and GAS41/NuBI1 suggests multiple TACC1-containing protein complexes in human cells.
11076968 2000 The centrosomal protein C-Nap1 is required for cell cycle-regulated centrosome cohesion.
9570755 1998 The TOGp protein is a new human microtubule-associated protein homologous to the Xenopus XMAP215.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8832653 1996 Expression of the tumor over-expressed ch-TOG gene in human and baboon brain.
8536682 1995 Characterization of the cDNA and pattern of expression of a new gene over-expressed in human hepatomas and colonic tumors.
7790358 1995 Cell cycle regulation of the activity and subcellular localization of Plk1, a human protein kinase implicated in mitotic spindle function.
7788527 1995 Prediction of the coding sequences of unidentified human genes. III. The coding sequences of 40 new genes (KIAA0081-KIAA0120) deduced by analysis of cDNA clones from human cell line KG-1.