Property Summary

NCBI Gene PubMed Count 48
PubMed Score 25.51
PubTator Score 42.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

 GO Function (1)

Protein-protein Interaction (3)

Gene RIF (35)

PMID Text
25849921 The still rudimentary information of how CLIMP-63 fulfills these different roles, what these are exactly and how post-translational modifications control them, will be discussed.
25008318 Although VIMP can interact with CLIMP-63 and Syn5L, it does not interact with MT-binding ER proteins (such as Reep1) that shape the tubular smooth ER
24838946 revealed that CKAP4 could associate with EGFR at basal status and the complex was reduced upon EGF stimulation, leading to release EGFR into cytoplasm
23921950 Here we report that the combination of p63, a master regulator of epidermal development and differentiation, and KLF4, a regulator of epidermal differentiation, is sufficient to convert dermal fibroblasts to a keratinocyte phenotype.
23913486 Single nucleotide polymorphisms in p63 are implicated in the etiology of nonsyndromic bladder-exstrophy-epispadias complex.
23665508 CKAP4 was correlated with favorable clinical outcome and was an independent predictor for overall survival in hepatic cholangiocarcinoma patients.
23108156 p63 positively regulates desmosome adhesion by directly controlling the expression of several desmosome genes, including Dsp, Dsc3 and Dsg1.
23047949 The results define CLIMP-63 as a novel protein interactor and regulator of Dicer function, involved in maintaining Dicer protein levels in human cells.
22966120 Treatment of airway epitheial cells (AEC) with SP-A, monoclonal antibodies to CKAP4/P63, or CKAP4/P63-specific small interfering RNA decreased the binding of purified alginate exopolysaccharide to AEC.
22438586 CCN2 regulation by antiproliferative factor involves CKAP4 nuclear translocation and binding to the CCN2 promoter.
22406481 Tumor markers, p63 and high molecular weight cytokeratin, may be utilised in the distinction between urothelial carcinoma with prostatic stromal invasion and urothelial carcinoma with colonisation of prostatic ducts and acini.
22329826 This study identifies specific changes in skin structural biology and signalling pathways that result from mutant p63 and provides new molecular insight into the AEC syndrome phenotype
22190034 HIV-1 gp41 is identified to have a physical interaction with cytoskeleton-associated protein 4 (CKAP4) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22056955 These findings strongly support the routine use of p40 in place of p63 for the diagnosis of pulmonary squamous cell carcinoma.
21820419 This study found a consistent expression profile and localization analysis of p63 and GM1 in primary keratinocytes and in human epidermal biopsies.
21655359 Telomere length in Sjogren syndrome is shorter and associated with lower levels of expression of p63 and nucleostemin than in non-Sjogren syndrome.
21143984 Synthetic as-antiproliferative factor inhibits cell proliferation in T24 bladder carcinoma cells via the CKAP4 receptor
21111237 CLIMP63 regulates the luminal diameter within the endoplasmic reticulum and may play a role in regulating the formation of endoplasmic reticulum sheets.
20870746 Data demonstrate an important role for the PI3-kinase-Akt pathway in intracellular transport of surfactant protein A receptor P63.
20808887 p63 binds to an enhancer element in the SHFM1 locus and this element controls expression of DLX6 and DLX5 which are important for limb development.
20184665 p63 was not found to be highly sensitive for squamous cell carcinoma
20156774 I510T mutation of p63 was detected in both RHS and AEC syndrome patients and mutation of S541 residue can lead to either RHS (S541Y) or AEC syndrome (S541F).
19861536 p73 and p63, but not p53, are modulated during the cell cycle
19144824 DHHC2-mediated palmitoylation of CKAP4 has a role in opposing cancer-related cellular behaviors.
18708633 Results substantiate the role of P63 as a lung surfactant protein-A receptor protein localized on the surface of lung type II cells.
18333895 CK MNF116 and p63 were useful in identifying squamous cell carcinomas with single cell infiltration.
18296695 Identification of CKAP4/p63 as a substrate of DHHC2, a putative tumor suppressor.
17975794 Olomoucine, a CDK inhibitor, up-regulates CKAP4, a cytoskeleton-linking membrane protein.
17030514 cytoskeleton-associated protein 4/p63 (CKAP4/p63), a type II transmembrane receptor, binds with high affinity to APF
16546853 is not responsible for autosomal-dominant amelogenesis imperfecta
15703217 CLIMP-63-mediated stable anchoring of the endoplasmic reticulum (ER) to microtubules is required to maintain the spatial distribution of the ER during interphase.
15476176 The ectrodactyly, absence of radius side part palm and split foot malformation are caused by the mutation of base pair at number 665 of the exon 5 of P63.
12913003 evidence to support the hypothesis that p63 is the functional tPA binding site on VSMC
8566419 Purification and cloning of p62/p63.
1730740 The p62/p63 protein was first identified because it is palmitoylated during mitosis.

AA Sequence

MPSAKQRGSKGGHGAASPSEKGAHPSGGADDVAKKPPPAPQQPPPPPAPHPQQHPQQHPQNQAHGKGGHR      1 - 70
GGGGGGGKSSSSSSASAAAAAAAASSSASCSRRLGRALNFLFYLALVAAAAFSGWCVHHVLEEVQQVRRS     71 - 140
HQDFSRQREELGQGLQGVEQKVQSLQATFGTFESILRSSQHKQDLTEKAVKQGESEVSRISEVLQKLQNE    141 - 210
ILKDLSDGIHVVKDARERDFTSLENTVEERLTELTKSINDNIAIFTEVQKRSQKEINDMKAKVASLEESE    211 - 280
GNKQDLKALKEAVKEIQTSAKSREWDMEALRSTLQTMESDIYTEVRELVSLKQEQQAFKEAADTERLALQ    281 - 350
ALTEKLLRSEESVSRLPEEIRRLEEELRQLKSDSHGPKEDGGFRHSEAFEALQQKSQGLDSRLQHVEDGV    351 - 420
LSMQVASARQTESLESLLSKSQEHEQRLAALQGRLEGLGSSEADQDGLASTVRSLGETQLVLYGDVEELK    421 - 490
RSVGELPSTVESLQKVQEQVHTLLSQDQAQAARLPPQDFLDRLSSLDNLKASVSQVEADLKMLRTAVDSL    491 - 560
VAYSVKIETNENNLESAKGLLDDLRNDLDRLFVKVEKIHEKV                                561 - 602
//

Text Mined References (57)

PMID Year Title
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25849921 2015 How many lives does CLIMP-63 have?
25008318 2014 Valosin-containing protein-interacting membrane protein (VIMP) links the endoplasmic reticulum with microtubules in concert with cytoskeleton-linking membrane protein (CLIMP)-63.
24838946 2014 CKAP4 inhibited growth and metastasis of hepatocellular carcinoma through regulating EGFR signaling.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23921950 2014 Highly rapid and efficient conversion of human fibroblasts to keratinocyte-like cells.
23913486 2013 Candidate gene association study implicates p63 in the etiology of nonsyndromic bladder-exstrophy-epispadias complex.
23665508 2013 Expression of cytoskeleton-associated protein 4 is related to lymphatic metastasis and indicates prognosis of intrahepatic cholangiocarcinoma patients after surgery resection.
23108156 2013 p63 control of desmosome gene expression and adhesion is compromised in AEC syndrome.
23047949 2012 Regulation of human Dicer by the resident ER membrane protein CLIMP-63.
22966120 2012 Surfactant protein A blocks recognition of Pseudomonas aeruginosa by CKAP4/P63 on airway epithelial cells.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22438586 2012 Antiproliferative factor regulates connective tissue growth factor (CTGF/CCN2) expression in T24 bladder carcinoma cells.
22406481 2012 Utility of p63 and high molecular weight cytokeratin in the distinction between urothelial carcinoma with prostatic stromal invasion and urothelial carcinoma with colonisation of prostatic ducts and acini.
22329826 2012 Mutations in AEC syndrome skin reveal a role for p63 in basement membrane adhesion, skin barrier integrity and hair follicle biology.
22056955 2012 p40 (?Np63) is superior to p63 for the diagnosis of pulmonary squamous cell carcinoma.
21820419 2011 The sterile alpha-motif (SAM) domain of p63 binds in vitro monoasialoganglioside (GM1) micelles.
21655359 2011 Comparison of telomere length and association with progenitor cell markers in lacrimal gland between Sjögren syndrome and non-Sjögren syndrome dry eye patients.
21269460 2011 Initial characterization of the human central proteome.
21143984 2010 Antiproliferative factor decreases Akt phosphorylation and alters gene expression via CKAP4 in T24 bladder carcinoma cells.
21111237 2010 Mechanisms determining the morphology of the peripheral ER.
20870746 2010 Role of the PI3-kinase signaling pathway in trafficking of the surfactant protein A receptor P63 (CKAP4) on type II pneumocytes.
20808887 2010 Genome-wide profiling of p63 DNA-binding sites identifies an element that regulates gene expression during limb development in the 7q21 SHFM1 locus.
20184665 2010 CD10, p63 and CD99 expression in the differential diagnosis of atypical fibroxanthoma, spindle cell squamous cell carcinoma and desmoplastic melanoma.
20156774 AEC syndrome caused by heterozygous mutation in the SAM domain of p63 gene.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19861536 2009 p73 and p63 sustain cellular growth by transcriptional activation of cell cycle progression genes.
19401338 2009 Role of syntaxin 18 in the organization of endoplasmic reticulum subdomains.
19144824 2009 Palmitoylation of cytoskeleton associated protein 4 by DHHC2 regulates antiproliferative factor-mediated signaling.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18708633 2008 Role of P63 (CKAP4) in binding of surfactant protein-A to type II pneumocytes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18333895 2008 Squamous cell carcinomas with single cell infiltration: a potential diagnostic pitfall and the utility of MNF116 and p63.
18296695 2008 Identification of CKAP4/p63 as a major substrate of the palmitoyl acyltransferase DHHC2, a putative tumor suppressor, using a novel proteomics method.
17975794 2007 A new, unexpected action of olomoucine, a CDK inhibitor, on normal human cells: up-regulation of CLIMP-63, a cytoskeleton-linking membrane protein.
17567679 2007 Climp-63-mediated binding of microtubules to the ER affects the lateral mobility of translocon complexes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17030514 2006 CKAP4/p63 is a receptor for the frizzled-8 protein-related antiproliferative factor from interstitial cystitis patients.
16546853 2006 Exclusion of p63 as a candidate gene for autosomal-dominant amelogenesis imperfecta.
16541075 2006 The finished DNA sequence of human chromosome 12.
16398404 The differential regulation of human telomerase reverse transcriptase and vascular endothelial growth factor may contribute to the clinically more aggressive behavior of p63-positive breast carcinomas.
15703217 2005 Phosphorylation controls CLIMP-63-mediated anchoring of the endoplasmic reticulum to microtubules.
15623521 2005 Interaction of microtubule-associated protein-2 and p63: a new link between microtubules and rough endoplasmic reticulum membranes in neurons.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15476176 2004 [One family investigation and pathogeny research on ectrodactyly, absence of radius side part palm and split foot malformation].
14741744 2004 Identification of major proteins in the lipid droplet-enriched fraction isolated from the human hepatocyte cell line HuH7.
12913003 2003 Functional regulation of tissue plasminogen activator on the surface of vascular smooth muscle cells by the type-II transmembrane protein p63 (CKAP4).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11402071 2001 Subdomain-specific localization of CLIMP-63 (p63) in the endoplasmic reticulum is mediated by its luminal alpha-helical segment.
8566419 1995 Protein palmitoylation in membrane trafficking.
8314870 1993 A reversibly palmitoylated resident protein (p63) of an ER-Golgi intermediate compartment is related to a circulatory shock resuscitation protein.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7673362 1995 Reassessment of the subcellular localization of p63.
1730740 1992 Mitosis and inhibition of intracellular transport stimulate palmitoylation of a 62-kD protein.