Property Summary

NCBI Gene PubMed Count 21
PubMed Score 27.76
PubTator Score 28.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
cutaneous lupus erythematosus -1.100 8.5e-03
psoriasis -3.200 4.0e-06
osteosarcoma -2.442 8.7e-07
atypical teratoid / rhabdoid tumor 1.100 2.3e-06
glioblastoma 1.200 2.8e-03
medulloblastoma, large-cell 1.400 2.8e-04
lung cancer 1.300 2.2e-02
group 4 medulloblastoma 1.100 4.5e-05

Gene RIF (13)

PMID Text
25778706 The results of this study showed CIZ1 will play a less important role in dystonia patient diagnosis than previously thought because variants of unclear significance are observed in approximately 1% of adult-onset sporadic dystonia patients in Germany.
25736292 CIZ1 is a kinase sensor that promotes initiation of DNA replication at low kinase levels, when in a hypophosphorylated state that is permissive for cyclin-A-CDK2 interaction and delivery to licensed origins.
25427641 Our study demonstrated that CIZ1 played an oncogenic role in the progression of GBC and CIZ1 might be a promising target for the treatment of GBC
24126760 CIZ1 may be involved in colon cancer progression by regulating cell proliferation, cell cycle, apoptosis and colony formation.
23813719 This study suggested that No mutations in CIZ1 in twelve adult-onset primary cervical dystonia families.
23074256 Variant Ciz1 is a strong candidate for a cancer-specific single marker capable of identifying early-stage lung cancer.
22447717 Mutations in CIZ1 may cause adult onset, primary cervical dystonia
20831784 alternatively spliced variant of Ciz1 is associated with cancer.
18583151 An isoform of CIZ1 which lacks a glutamine-rich region, due to alternative splicing in exon 8, is upregulated in Alzheimer's brains relative to the full-length CIZ1 protein.
18081865 Ciz1 is a nuclear zinc finger protein interacting with p21, and is a DNA replication factor. The region of Ciz1 necessary for the interaction with ERH spans residues 531-644, encompassing its first zinc finger motif
17508423 conditional exclusion of exon 4 influences the spatial distribution of the Ciz1 protein within the nucleus, showing that CIZ1 alternative splicing could influence organized patterns of DNA replication
17108141 Findings revealed the inherent role of Ciz1, a novel DNA binding and ER coactivator, in amplifying estrogenic responses and promoting breast cancer tumorigenesis.
12824700 data indicate that Ciz1 is localized in the nucleus and is expressed in a wide range of tissues, especially the pancreas and the brain; formulated a consensus DNA sequence, ARYSR(0-2)YYAC, recognized by Ciz1

AA Sequence

MFSQQQQQQLQQQQQQLQQLQQQQLQQQQLQQQQLLQLQQLLQQSPPQAPLPMAVSRGLPPQQPQQPLLN      1 - 70
LQGTNSASLLNGSMLQRALLLQQLQGLDQFAMPPATYDTAGLTMPTATLGNLRGYGMASPGLAAPSLTPP     71 - 140
QLATPNLQQFFPQATRQSLLGPPPVGVPMNPSQFNLSGRNPQKQARTSSSTTPNRKDSSSQTMPVEDKSD    141 - 210
PPEGSEEAAEPRMDTPEDQDLPPCPEDIAKEKRTPAPEPEPCEASELPAKRLRSSEEPTEKEPPGQLQVK    211 - 280
AQPQARMTVPKQTQTPDLLPEALEAQVLPRFQPRVLQVQAQVQSQTQPRIPSTDTQVQPKLQKQAQTQTS    281 - 350
PEHLVLQQKQVQPQLQQEAEPQKQVQPQVQPQAHSQGPRQVQLQQEAEPLKQVQPQVQPQAHSQPPRQVQ    351 - 420
LQLQKQVQTQTYPQVHTQAQPSVQPQEHPPAQVSVQPPEQTHEQPHTQPQVSLLAPEQTPVVVHVCGLEM    421 - 490
PPDAVEAGGGMEKTLPEPVGTQVSMEEIQNESACGLDVGECENRAREMPGVWGAGGSLKVTILQSSDSRA    491 - 560
FSTVPLTPVPRPSDSVSSTPAATSTPSKQALQFFCYICKASCSSQQEFQDHMSEPQHQQRLGEIQHMSQA    561 - 630
CLLSLLPVPRDVLETEDEEPPPRRWCNTCQLYYMGDLIQHRRTQDHKIAKQSLRPFCTVCNRYFKTPRKF    631 - 700
VEHVKSQGHKDKAKELKSLEKEIAGQDEDHFITVDAVGCFEGDEEEEEDDEDEEEIEVEEELCKQVRSRD    701 - 770
ISREEWKGSETYSPNTAYGVDFLVPVMGYICRICHKFYHSNSGAQLSHCKSLGHFENLQKYKAAKNPSPT    771 - 840
TRPVSRRCAINARNALTALFTSSGRPPSQPNTQDKTPSKVTARPSQPPLPRRSTRLKT                841 - 898
//

Text Mined References (30)

PMID Year Title
25778706 2015 Mutations in CIZ1 are not a major cause for dystonia in Germany.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25736292 2015 Cyclin-A-CDK2-mediated phosphorylation of CIZ1 blocks replisome formation and initiation of mammalian DNA replication.
25427641 2015 CIZ1 promoted the growth and migration of gallbladder cancer cells.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24126760 2013 CIZ1 regulates the proliferation, cycle distribution and colony formation of RKO human colorectal cancer cells.
23813719 2013 No mutations in CIZ1 in twelve adult-onset primary cervical dystonia families.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23074256 2012 Variant Ciz1 is a circulating biomarker for early-stage lung cancer.
22447717 2012 Mutations in CIZ1 cause adult onset primary cervical dystonia.
20831784 2010 Differential detection of alternatively spliced variants of Ciz1 in normal and cancer cells using a custom exon-junction microarray.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18654987 2008 Identification of multi-SH3 domain-containing protein interactome in pancreatic cancer: a yeast two-hybrid approach.
18583151 2008 Altered splicing in exon 8 of the DNA replication factor CIZ1 affects subnuclear distribution and is associated with Alzheimer's disease.
18081865 2008 Ciz1, a p21 cip1/Waf1-interacting zinc finger protein and DNA replication factor, is a novel molecular partner for human enhancer of rudimentary homolog.
17508423 2007 Cancer-associated missplicing of exon 4 influences the subnuclear distribution of the DNA replication factor CIZ1.
17108141 2006 Ciz1, a Novel DNA-binding coactivator of the estrogen receptor alpha, confers hypersensitivity to estrogen action.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16341674 2005 Transcriptome analysis of human gastric cancer.
15585571 2005 Ciz1 promotes mammalian DNA replication.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12824700 Ciz1, Cip1 interacting zinc finger protein 1 binds the consensus DNA sequence ARYSR(0-2)YYAC.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10529385 1999 Cloning and characterization of a novel p21(Cip1/Waf1)-interacting zinc finger protein, ciz1.
10369878 1999 Extensive gene order differences within regions of conserved synteny between the Fugu and human genomes: implications for chromosomal evolution and the cloning of disease genes.