Property Summary

NCBI Gene PubMed Count 10
PubMed Score 14.26
PubTator Score 8.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 1.4e-06
lung adenocarcinoma 2716 1.1e-04
inflammatory breast cancer 286 2.4e-02

Expression

  Differential Expression (3)

Disease log2 FC p
inflammatory breast cancer -1.300 2.4e-02
lung adenocarcinoma -1.200 1.1e-04
ovarian cancer 1.100 1.4e-06

Gene RIF (8)

AA Sequence

MADHLMLAEGYRLVQRPPSAAAAHGPHALRTLPPYAGPGLDSGLRPRGAPLGPPPPRQPGALAYGAFGPP      1 - 70
SSFQPFPAVPPPAAGIAHLQPVATPYPGRAAAPPNAPGGPPGPQPAPSAAAPPPPAHALGGMDAELIDEE     71 - 140
ALTSLELELGLHRVRELPELFLGQSEFDCFSDLGSAPPAGSVSC                              141 - 184
//

Text Mined References (10)

PMID Year Title