Property Summary

NCBI Gene PubMed Count 53
PubMed Score 126.69
PubTator Score 55.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (26)

Disease log2 FC p
nephrosclerosis 1.013 5.6e-04
Barrett's esophagus -1.500 2.4e-02
esophageal adenocarcinoma -2.200 3.3e-02
osteosarcoma -1.407 4.1e-02
group 4 medulloblastoma 1.800 3.5e-02
astrocytoma 1.100 4.9e-02
glioblastoma -1.200 2.2e-02
medulloblastoma, large-cell -2.300 8.4e-04
ulcerative colitis -1.800 3.4e-04
autosomal dominant Emery-Dreifuss muscul... 1.623 7.3e-03
fascioscapulohumeral muscular dystrophy 1.186 4.6e-03
juvenile dermatomyositis 1.285 7.8e-06
Atopic dermatitis -2.700 8.5e-06
non-small cell lung cancer -1.831 7.7e-18
intraductal papillary-mucinous adenoma (... -1.500 7.3e-04
intraductal papillary-mucinous carcinoma... -1.700 4.2e-04
intraductal papillary-mucinous neoplasm ... -1.700 2.8e-03
lung cancer -4.700 1.0e-07
colon cancer -1.900 1.8e-02
fibroadenoma -1.200 5.7e-04
atypical teratoid/rhabdoid tumor 1.400 4.7e-02
pilocytic astrocytoma -1.200 1.7e-02
aldosterone-producing adenoma -1.957 1.5e-02
lung carcinoma -1.200 1.7e-13
spina bifida -2.260 3.1e-02
ovarian cancer -2.100 8.6e-08

Protein-protein Interaction (2)

Gene RIF (28)

PMID Text
26851278 Intrinsic protein disorder plays a prominent role in the function and interactions of the transcriptional co-activators CBP and p300. (Review)
25956243 FBXL5-mediated degradation of CITED2 leads to the activation of HIF-1 alpha.
25184385 The increased CITED2 expression in acute myeloid leukemia results in better hematopoietic stem cell survival, lower PU.1 levels, and perturbed myeloid differentiation program that contributes to leukemia persistence.
24848765 CITED2 has a potential causative impact on congenital heart disease
24456003 Our study suggests that CITED2 gene mutations and methylation may play an important role in the development of pediatric congenital heart disease.
23811274 data indicate that CITED2 functions as a transcriptional co-activator of ER in breast cancer cells and that its increased expression in tumors may result in estrogen-independent ER activation
23212831 CITED2 is a direct effector of PPARgamma for tumor suppression.
23082118 CITED2 is phosphorylated by MAPK1 in vitro at T166, and that MAPK1 activation enhances the coactivation function of CITED2 but not of CITED2-T166N.
22814619 CITED2 functions as a molecular switch of TGF-alpha and TGF-beta-induced growth control, and MYC-CITED2 signaling axis provides a new index for predicting clinical outcome.
22735262 CITED2 variants decreased its ability to mediate the expression of vascular endothelial growth factor (VEGF) and the expression of the paired-like homeodomain transcription factor 2-gamma (PITX2C), both of which are closely related to cardiac development.
22709740 We conclude that mutations in CITED2 may be involved in premature ovarian failure pathogenesis.
21660965 A combination of cisplatin and CITED2 shRNA may represent an effective treatment against p53-sensitive cancer cells.
21165656 CITED2 activation may induce mucosal apoptosis and erosion by activating p53 and thus play a critical role in linking enteric bacteria with mucosal inflammation in ulcerative colitis.
21098220 CITED2 is a novel regulator of NF-kappaB in the nucleus, which reveals a negative feedback mechanism for NF-kappaB signaling.
20932315 Observational study of gene-disease association. (HuGE Navigator)
20654020 Observational study of gene-disease association. (HuGE Navigator)
20392269 CITED2 may act as a mechanosensitive molecular switch regulating cartilage matrix breakdown.
19904269 Both NCOR2 and CITED2 mRNA levels were associated with MFS, that is, tumour aggressiveness, independently of traditional prognostic factors
19642106 Reducing CITED2 expression in a mammary tumor cell line inhibits the establishment of bone metastasis and osteolysis in vivo.
19319572 The effects of endothelial-cell-conditioned medium (ECCM), as produced during the incubation of human umbilical vein endothelial cells for 24 h, on the promoter activity and mRNA and protein expression of CITED2 in adrenocortical cells, was examined.
18984668 CITED2 and PBX1 are likely to be important mediators of adrenal development and function in humans, but mutations in these genes are not common causes of adrenal failure.
18054336 CITED2 regulates colon cancer invasion and might be a target for histone deacetylase inhibitor-based intervention of colon cancer.
17932483 Cited2, a coactivator of HNF4alpha, is essential for liver development
16675452 TGF-beta-mediated down-regulation of Cited2 is post-transcriptional, through the Smad pathway, and requires the presence of its coding sequence
16287139 Observational study of gene-disease association. (HuGE Navigator)
16287139 CITED2 mutations have a causative impact in the development of CHD in humans.
15051727 CIT-ED2 is a coactivator of PPARalpha and both proteins may participate in signaling cascades of hypoxic response and angiogenesis
12960175 Both TGFbeta and flow shear stimulated expression of CITED2 and also association of CIT-ED2 with p300 by dissociating Ets-1 from p300. Thus, CITED2 plays a major role in shear-induced down-regulation of MMP-1 and MMP-13 via a TGFbeta-dependent pathway.

AA Sequence

MADHMMAMNHGRFPDGTNGLHHHPAHRMGMGQFPSPHHHQQQQPQHAFNALMGEHIHYGAGNMNATSGIR      1 - 70
HAMGPGTVNGGHPPSALAPAARFNNSQFMGPPVASQGGSLPASMQLQKLNNQYFNHHPYPHNHYMPDLHP     71 - 140
AAGHQMNGTNQHFRDCNPKHSGGSSTPGGSGGSSTPGGSGSSSGGGAGSSNSGGGSGSGNMPASVAHVPA    141 - 210
AMLPPNVIDTDFIDEEVLMSLVIEMGLDRIKELPELWLGQNEFDFMTDFVCKQQPSRVSC              211 - 270
//

Text Mined References (56)

PMID Year Title
26851278 2016 Role of Intrinsic Protein Disorder in the Function and Interactions of the Transcriptional Coactivators CREB-binding Protein (CBP) and p300.
25956243 2015 FBXL5 modulates HIF-1? transcriptional activity by degradation of CITED2.
25184385 2015 CITED2-mediated human hematopoietic stem cell maintenance is critical for acute myeloid leukemia.
24848765 2014 Variations of CITED2 are associated with congenital heart disease (CHD) in Chinese population.
24456003 2014 CITED2 mutation and methylation in children with congenital heart disease.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23811274 2013 CITED2 modulates estrogen receptor transcriptional activity in breast cancer cells.
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
23263863 2013 GWAS of blood cell traits identifies novel associated loci and epistatic interactions in Caucasian and African-American children.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
23212831 2013 CITED2 is a novel direct effector of peroxisome proliferator-activated receptor ? in suppressing hepatocellular carcinoma cell growth.
23082118 2012 Functional significance of SRJ domain mutations in CITED2.
22814619 2012 CITED2 functions as a molecular switch of cytokine-induced proliferation and quiescence.
22735262 2012 CITED2 mutation links congenital heart defects to dysregulation of the cardiac gene VEGF and PITX2C expression.
22709740 2012 CITED2 mutations potentially cause idiopathic premature ovarian failure.
21660965 2011 Knockdown of CITED2 using short-hairpin RNA sensitizes cancer cells to cisplatin through stabilization of p53 and enhancement of p53-dependent apoptosis.
21165656 2011 CITED2 is activated in ulcerative colitis and induces p53-dependent apoptosis in response to butyric acid.
21098220 2011 Negative feedback regulation of NF-?B action by CITED2 in the nucleus.
20932315 2010 Genes encoding critical transcriptional activators for murine neural tube development and human spina bifida: a case-control study.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20654020 2010 [Mutation analysis of Cited2 in patients with congenital heart disease].
20392269 2010 CITED2 mechanoregulation of matrix metalloproteinases.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
19904269 2009 CITED2 and NCOR2 in anti-oestrogen resistance and progression of breast cancer.
19862010 2009 Multiple loci influence erythrocyte phenotypes in the CHARGE Consortium.
19642106 2010 Identification of prospective factors promoting osteotropism in breast cancer: a potential role for CITED2.
19319572 2009 Evidence for the involvement of endothelial cell products in adrenal CITED2 expression.
18984668 2009 CBP/p300-interacting transactivator, with Glu/Asp-rich C-terminal domain, 2, and pre-B-cell leukemia transcription factor 1 in human adrenal development and disease.
18054336 2007 A role for CITED2, a CBP/p300 interacting protein, in colon cancer cell invasion.
17932483 2007 Cited2, a coactivator of HNF4alpha, is essential for liver development.
17906695 2008 CITED2 mediates the paradoxical responses of HIF-1alpha to proteasome inhibition.
16675452 2006 Post-transcriptional control of Cited2 by transforming growth factor beta. Regulation via Smads and Cited2 coding region.
16341674 2005 Transcriptome analysis of human gastric cancer.
16287139 2005 Identification and functional analysis of CITED2 mutations in patients with congenital heart defects.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15051727 2004 Identification of the CREB-binding protein/p300-interacting protein CITED2 as a peroxisome proliferator-activated receptor alpha coregulator.
14633989 2003 Role of acetylated human AP-endonuclease (APE1/Ref-1) in regulation of the parathyroid hormone gene.
14594809 2004 Interaction of the TAZ1 domain of the CREB-binding protein with the activation domain of CITED2: regulation by competition between intrinsically unstructured ligands for non-identical binding sites.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12960175 2003 CITED2-mediated regulation of MMP-1 and MMP-13 in human chondrocytes under flow shear.
12778114 2003 Structural basis for negative regulation of hypoxia-inducible factor-1alpha by CITED2.
12762840 Novel complex integrating mitochondria and the microtubular cytoskeleton with chromosome remodeling and tumor suppressor RASSF1 deduced by in silico homology analysis, interaction cloning in yeast, and colocalization in cultured cells.
12586840 2003 Physical and functional interactions among AP-2 transcription factors, p300/CREB-binding protein, and CITED2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11744733 2002 Human CREB-binding protein/p300-interacting transactivator with ED-rich tail (CITED) 4, a new member of the CITED family, functions as a co-activator for transcription factor AP-2.
11694877 2001 Cardiac malformations, adrenal agenesis, neural crest defects and exencephaly in mice lacking Cited2, a new Tfap2 co-activator.
11597177 2001 Identification and initial characterization of 5000 expressed sequenced tags (ESTs) each from adult human normal and osteoarthritic cartilage cDNA libraries.
11581164 2001 Selective coactivation of estrogen-dependent transcription by CITED1 CBP/p300-binding protein.
10593900 1999 MRG1 binds to the LIM domain of Lhx2 and may function as a coactivator to stimulate glycoprotein hormone alpha-subunit gene expression.
10552932 1999 Molecular cloning and chromosomal localization of the human CITED2 gene encoding p35srj/Mrg1.
9887100 1999 Functional role of p35srj, a novel p300/CBP binding protein, during transactivation by HIF-1.
9811838 1998 MRG1, the product of a melanocyte-specific gene related gene, is a cytokine-inducible transcription factor with transformation activity.
9434189 1997 MSG1 and its related protein MRG1 share a transcription activating domain.
8901575 1996 msg1, a novel melanocyte-specific gene, encodes a nuclear protein and is associated with pigmentation.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.